This version is not peer-reviewed.
Submitted:
28 April 2024
Posted:
29 April 2024
You are already at the latest version
A peer-reviewed article of this preprint also exists.
supplementary.pdf (739.24KB )
Bacteria strain | Causative agents |
Bacillus cereus NBIMCC 1085 | Foodborne disease |
Propionibacterium acnes DSM 1897 | Skin condition of acne, chronic endophthalmitis, corneal ulcers, sarcoidosis, etc. |
Salmonella enterica NBIMCC 8691 | Salmonellosis |
Enterococcus faecalis NBIMCC 3915 | Endocarditis, sepsis, urinary tract infections (UTIs), meningitis, etc. |
Enterococcus faecium NBIMMCC 8754 | Bloodstream infections, urinary tract infections (UTIs), and wound infections associated with catheters or surgery are the most common infections. |
No | Amino Acid Sequence of Peptides | [M+H]+ Da |
Calcul. monois. mass Da | pI | GRAVY | Net Charge | Predicted by iAMPpred software | ||
---|---|---|---|---|---|---|---|---|---|
Аntibacterial (%) | Аntiviral (%) | Аntifungal (%) | |||||||
1 | LLPFKEPDL | 1071.60 | 1070.60 | 4.37 | −0.600 | −2/+1 | 28 | 51 | 19 |
2 | ACGATLQLENCG | 1179.77 | 1178.51 | 4.00 | +0.350 | -1/0 | 29.3 | 35.7 | 43.7 |
3 | LNLGGNGANGLVGG | 1212.76 | 1211.63 | 5.52 | +0.321 | 0/0 | 74.0 | 43.1 | 74.3 |
4 | AGVGGAAGNPSTYVG | 1277.70 | 1276.60 | 5.57 | +0.260 | 0/0 | 25.1 | 7.4 | 11.3 |
5 | GGGMVKEDGSCLGV | 1308.77 | 1307.58 | 4.37 | +0.207 | −2/+1 | 40.4 | 31.4 | 33.7 |
6a | MLGGGVNSLRPPK | 1325.80 | 1324.73 | 11.0 | −0.262 | 0/+2 | 22.8 | 14.0 | 8.9 |
7 | CVGGAGGHGDSCAKGT | 1376.53 | 1375.56 | 6.73 | −0.106 | −1/+1 | 85.2 | 48.8 | 74.4 |
8 | GGGGYHTWGEGGKF | 1409.48 | 1408.62 | 6.75 | −0.964 | −1/+1 | 69.0 | 62.8 | 72.6 |
9 | MLNVAVNKGEVKH | 1438.86 | 1437.78 | 8.37 | −0.138 | −1/+2 | 56.4 | 38.0 | 19.7 |
10b | NLVGGSGGGGRGGANPLG | 1496.79 | 1495.75 | 9.75 | −0.217 | 0/+1 | 66.0 | 33.7 | 48.2 |
11 | GTMSPAGGEMGPVTAGVG | 1576.04 | 1574.71 | 4.00 | +0.250 | −1/0 | 13.1 | 24.8 | 8.3 |
12 | GTKGCGPGSCPPGDTVAGVG | 1716.79 | 1715.76 | 5.82 | −0.100 | −1/+1 | 23.8 | 20.2 | 25.8 |
13c | ACSLLLGGGGVGGGKGGGGHAG | 1738.96 | 1737.86 | 8.27 | +0.409 | 0/+1 | 82.6 | 49.5 | 67.0 |
14a | LLLDGFGGGLLVEHDPGS | 1796.00 | 1794.92 | 4.02 | +0.439 | -3/0 | 37 | 45 | 10 |
15d | MGGWGGLGGGHNGGWMPPK | 1852.96 | 1851.83 | 8.52 | −0.611 | 0/+1 | 69 | 56.0 | 57.0 |
16c | ACLTPVDHFFAGMPCGGGP | 1876.88 | 1875.81 | 5.08 | +0.542 | −1/0 | 32.4 | 42.6 | 20.1 |
17c | NGLFGGLGGGGHGGGGKGPGEGGG | 1909.98 | 1908.88 | 6.75 | −0.487 | −1/+1 | 89.5 | 67.2 | 79.5 |
18 | LLLDNKGGGLVGGLLGGGGKGGG | 1966.11 | 1965.10 | 8.59 | +0.322 | −1/+2 | 93 | 56 | 81 |
19 | GMVLLHCSPALDFHKTPAV | 2036.09 | 2035.04 | 6.91 | +0.616 | −1/+1 | 18 | 53 | 14 |
20 | LPFLLGVGGLLGGSVGGGGGGGGAPL | 2136.24 | 2135.17 | 5.52 | +1.023 | 0/0 | 66 | 33 | 36 |
21 | MVLDGKGGGGLLGGVLGGGKDAHLGG | 2292.32 | 2291.21 | 6.50 | +0.319 | −2/+2 | 84.3 | 59.0 | 71 |
22 | LLKDNGVGGLLGGGGAGGGGLVGGNLGGGAG | 2478.39 | 2477.30 | 5.84 | +0.439 | −1/+1 | 86.4 | 54 | 66 |
23 | KTSKLMVYLAGGGGGLLGGVGGGGGGAGGGGPGGL | 2843.76 | 2842.48 | 9.70 | +0.374 | 0/+2 | 76 | 47 | 67 |
Band кDa |
AAS of peptide | Mass [M+H]+ | Protein name | UniProt ID | Identities |
---|---|---|---|---|---|
17.5 | TAAFTEDTSVVTGR | 1454.63 | mucus protein [Cornu aspersum] | QEG59314.1 | 86%, E=8e-05 |
FTAAFTEDTSVAEGR | 1601.74 | mucus protein [C. aspersum] | QEG59314.1 | 100%, E=2e-09 | |
GNVAFTAAFTEDTSVAEGR | 1942.91 | mucus protein [C. aspersum] | QEG59314.1 | 100%, E=4e-13 | |
GALNGNVAFTAAFTEDTSVAEGR | 2298.10 | mucus protein [C. aspersum] | QEG59314.1 | 100%,E=2e-11 | |
23.6 | GSCNWPMTILMLESLR | 1850.90 | NADH subunit 6 [Albinaria caerulea] | P48922 | 78%, E=0.005 |
QYLQITWPSPR | 1388.7 | H-type lectin domain-cont. Protein B. glabrata | KAI8776186.1 | 100%,E=0.041 | |
26.7 | VPSDDPGR | 842.40 | Chain A, H. aspersa agglutinin[C. aspersum] | 4Q56_A | 100%,E=0.003 |
DITFASPYCR | 1172.54 | Chain A, H. aspersa agglutinin C. aspersum | 4Q56_A | 90%,E=1e-04 | |
NGGLVHPGPR | 1003.54 | uncharacterized protein [Pomacea canaliculata] | XP_025078819.1 | 89%, E=4.5 | |
31.35 | DWTLYVNTPLAPAR | 1616.84 | unnamed protein, partial [C. unifasciata] mucin 18b [Plakobranchus ocellatus] |
GFO09821.1 | 78%, E=0.33 75%, E=27 |
FCPNAQRTR | 1092.54 | glutathione S-transferase omega-1-like [P. Canaliculata] [Elysia marginata] |
XP_025114871.1 GFR70608.1 |
89%, E=0.31 89%, E=0.31 |
|
NPVGSVPVLELDGK | 1423.78 | glutathione S-transferase omega-1[P. Canaliculata] [B. Glabrata] containing protein [B.glabrata] |
XP_025099831.1 KAI8762368.1 |
86%, E=0.013 79%, E=0.02 |
|
33.0 | GPCFTPHTYTNWSWLR | 1965.91 | unnamed protein, Candidula unifasciata] “Bacterial protein of unknown function (HtrL_YibB) | CAG5121511.1 | 63%, E=4e-04 |
DFLPPASLPDFAPSPPRVAER | 2279.18 | unnamed protein product, [Candidula unifasciata] | CAG5136685.1 | 53%, E=0.34 | |
39.1 | AGYLQITWPSPR | 1388.72 | mucus protein [C. aspersum] H-type lectin domain- |
QEG59312.1 KAI8776186.1 |
100%,E=1e-08 100% E=0.055 |
ASVTGDLSNK | 991.51 | mucus protein [C. aspersum] | QEG59312.1 | 100%,E=8e-04 | |
ELLGNVYRAAFTEDTSVAEGR | 2298.14 | mucus protein [C. aspersum] | QEG59314.1 | 77%, E=3e-08 | |
VGSNGAR | 660.34 | mucus protein [C. aspersum] | QEG59312.1 | 100%E=0.004 | |
ANVTFDLSEK | 1123.56 | von Willebrand factor A domain-containing protein 3B-like isoform X1 [B. glabrata] protein 3B isoform X2, [B. glabrata] |
XP_013069929.2 XP_013069930.2 |
100%, E=0.59 100%, E=0.59 |
|
LFSTASGGR | 895.4632 | Collagen alpha-6(VI) chain, partial [Biomphalaria pfeifferi] | KAK0040452.1 | 89% E=1.9 | |
LPLYEDPKLDVSSLR | 1744.83 | uncharacterized protein LOC101853718 [A. californica] | XP_012941625.1 | 83%, E=0.27 | |
48.7 | FDANPFFSGR | 1157.59 | Hemocyanin, βC chain unit D [Helix pomatia] | P12031.2 | 89%, E=9e-06 |
HGSPIGVPYWDWTR | 1670.93 | Hemocyanin α N [C. aspersum] | AYO86684.1 | 100%, E=2e-09 | |
LISEATYFNSR | 1300.71 | hemocyanin β [C. aspersum] βC chain unit D [H. pomatia] |
AYO86685.1, P12031.2 |
100%, E=2e-04 82%, E=6e-05 |
|
FDPNPFFSGR | 1183.5 | Hemocyanin, βC chain unit D [H. pomatia] | P12031.2 | 100%,E=3e-07 | |
EVFEQVEHALLAR | 1540.81 | Hemocyanin β [C. aspersum] βC chain unit D [H. pomatia] |
AYO86685.1 P12031.2 |
100%, E=0.006 88%, E=0.050 |
|
QYLQITWSPPR | 1388.73 | fibrinogen-like protein A isoform [B. glabrata] | XP_055864456.1 | 78%, E=1.4 | |
52.8 | TDVTSALLGARCNEGGTNTHSPLR | 2470.21 | unnamed protein, partial [C. unifasciata] unnamed protein C. unifasciata |
CAG5131631.1 CAG5131621.1 |
70%, E=0.006 63%, E=0.26 |
LTQHFNVGSNGAR | 1400.70 | mucus protein [C. aspersum] unnamed protein C. unifasciata unnamed protein partial [C. unifasciata] |
QEG59312.1 CAG5131621.1 CAG5131631.1 |
92%,E=0.001 77%, E=0.094 75%, E= 0.38 |
|
MPDYDCGCCNGSNGSYGSGGGGGGGR | 2384.84 | unnamed protein, partial [C.unifasciata] unnamed protein product [C. unifasciata] |
CAG5126455.1 CAG5131834.1 |
80% , Е=0.23 63% Е=0.23 |
|
56.9 | DGMSAAPQAENAFALK | 1620.77 | Achacin; Flags: Precursor [L. Fulica] L-amino-acid oxidase (Escapin) A. Californica |
P35903.1 Q6IWZ0.1 |
71%, E=3e-04 63%, Е=0.95 |
SGFPTTSKDR | 1095.54 | L-amino-acid oxidase (Escapin) [A. Californica | Q6IWZ0.1 | 100%, E=0.080 | |
VGGGPSGVELDEFEARVELK | 2088.0 | Achacin ; Flags : Precursor [Lissachatina fulica] | P35903.1 | 41% E=0.40 | |
AELKGDMQYTYADSEKVR | 2104.00 | fibrillin-3, partial [Biomphalaria pfeifferi] fibrillin-3, partial [B. Glabrata] |
KAK0048148.1 KAK6970092.1 |
48%, Е=0.22 48%, Е=0.22 |
|
70.8 | AKVQVIGVPDDRLLLR | 1792.08 | acyl-CoA synthetase family member 2, mito- chondrial-like, partial [Pomacea canaliculata] unnamed protein product, [C. unifasciata] |
XP_025086706.1 CAG5136482 |
91%, E=0.005 91%, E=0.005 |
HGGGGGGFGGGGFGSR | 1320.65 | uncharacterized protein LOC124113905 [H. rufescens fibroin heavy chain isoform X1 [A. Californica] elastin-like [Ostrea edulis] Glycine, alanine asparagine -rich protein [Haliotis asinina] |
XP_046330350.2 XP_012943828.1 XP_056017499.1 P86732.1 |
100%,E=9e-04 81%, E=0.018 87%, E=0.038 65%, E=0.004 |
|
84.7 | YVLEDLSAADLELSR | 1693.86 | FMRFamide-activatedamiloride-sensitive sodium channel [C. aspersum] | Q25011.1 | 100%, E=0.14 |
GSSVSLCVWDWAVLPR | 1774.8 | FMRFamide-activatedamiloride-sensitive sodium channel [C. aspersum] | Q25011.1 | 71%, E= 1.9 | |
97.0 | MVTSLYPGEDWAMLPR | 1865.89 | mucin-5AC-like, partial [Haliotis rufescens] | XP_048239711.1 | 56%, E= 0.15 |
ETVSPGYSEGECTCASITQK | 2089.91 | mucin-5B-like isoform X4 [H. rubra] | XP_046552239.1 | 62%, E= 6.7 | |
VFADFELHNIGASADVR | 1860.92 | hemocyanin β [C. aspersum] | AYO86685.1 | 100%, E= 2e-10 | |
CQVSLPYWDWAVPLR | 1832.92 | hemocyanin, βC chain unit G [H. pomatia] | P56823.1 | 100%, E= 5e-04 | |
LSGYDVSKVNEILK | 1564.86 | hemocyanin β [C. aspersum] | AYO86685.1 | 85%, E=8e-05 | |
HLWLLHCFEHDLNGYEYDNLR | 2687.25 | hemocyanin β [C. aspersum] | AYO86685.1 | 87% E=8e-06 | |
ANNARLTDASHDNPFSSYTLR | 2350.12 | hemocyanin β [C. aspersum] | AYO86685.1 | 94%, E=1e-09 | |
143.3 | VGRIESESYVVKKSK | 1708.96 | zinc finger protein 502-like [B. glabrata] 184 [B. glabrata] |
XP_055863608 KAI8795828.1 |
77%, E=0.12 77%, E=0.12 |
VLTFYQSCDCVVDHCHR | 2024.88 | zinc finger protein 664-like [Patella vulgata] | XP_050401404.1 | 75%, E=1.5 | |
GEPGSTGPPGLK | 1096.56 | collagen alpha-1(IV) chain-like, partial [P. canaliculata] | XP_025114158.1 | 100%, E=2e-04 | |
NGPSGVELDEFEARVELK | 1988.99 | collagen alpha-1(XIII) chain – like isoform X7 [H. rubra] | XP_046573418.1 | 59%, E=2.5 | |
FVDMDGMFSSAAGGRPEAR | 2000.89 | collagen α-4(VI) chain-like X2 [P. acuta] α-1(XII) chain-like [P. acuta] α-1(XII) chain-like isoform X6 [B. glabrata] |
XP_059154404.1 XP_059163536.1 XP_055860588.1 |
73%, E= 0.012 75%, E=0.26 68%, E=0.26 |
|
RAYTDGMFSSAAGGRPEAR | 1999.94 | collagen α-4(VI) chain-like isoform [P. acuta] collagen α-4(VI) chain-like isoform [P. acuta] |
XP_059154404.1 XP_059154396.1 |
79%,E=0.031 79%, E=0.031 |
|
CNEGGTNTHSPLR | 1385.62 | collagen α-6(VI) chain-like [Physella acuta] | XP_059164377.1 | 89%, E=6.1 | |
198.31 | NPGYLVSKVNEILK | 1573.89 | mucin-2-like [P. acuta] serine/arginine repetitive matrix protein 2 [B. glabrata] | XP_059140993.1 KAI8735946.1 |
71%, E=0.84; 71%, E=0.84 |
DCRVRVGGPLFAPSPYLFER | 2279.1 | mucin-17-like [Haliotis rubra] | XP_046554219.1 | 52%,E=0.78 | |
FNFLPLSADALESLR | 1692.90 | E3 ubiquitin-protein ligase HERC2-like isoform X2 [B. glabrata] | XP_055894969.1 | 83%, E= 0.50 | |
ASSGSCDFSSSTAANR | 1547.64 | mucin-5AC-like isoform X2 [H. rufescens] mucin-5AC-like isoform X1 [H. rufescens] |
XP_048252836.1 XP_048252834.1 |
85%,E= 0.45 85%,E= 0.45 |
|
GCAGCPQAGSK | 978.41 | fibrillin-1-like [B. glabrata] | XP_055888733.1 | 89%, Е=2.9 |
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content. |
Downloads
119
Views
71
Comments
0
Subscription
Notify me about updates to this article or when a peer-reviewed version is published.
© 2025 MDPI (Basel, Switzerland) unless otherwise stated