The paper aims to investigate on the determinants of the capital structure of the Italian SMEs and it is based on a large panel of Italian manufacturing SMEs observed in the years 2001-2013. The analysis achieves a comparative investigation between the capital structure of the firms belonging in the Southern region, the so-called Italian Mezzogiorno that is the slow growing area of the country, and the firms of the Center-northern region of Italy, that is the more developed area of the country. Fixed effect panel techniques applied to the several standard leverage models allows to reaffirm some distinctive features showing differences of the financial behavior of regional firms.

The microspheres constituted by proteinoids synthesized from Fox’s simulation experiments. They had peptide bond structure and weak catalysis, as well as proliferated themselves. Such microspheres were believed the models for primitive life. Due to lack of metabolism and self-reproduction, the microspheres could not meet requirements of life. Thus, how microspheres could evolved into primitive life remain unsolved mysteries. The microspheres were supposed a dissipative structure and the processes of absorption and hydrolysis could be balanced to maintain their stability by consuming proteinoid. Proteinoid molecules differed in their life spans, which were mainly determined by their multi-space structures. Consequently, molecule selection and retention could occur spontaneously in microspheres and lead to a more organized and stabilized structure of the whole microsphere with time through dissipative process. More complex chain network of chemical reactions could happen in microspheres because the proteinoid with complex, ordered multi-space structure and relatively high catalytic activity would retain. In such microspheres, nucleotides could produce and further aggregate into RNA. The synthesis of real proteins could take place with RNA as the template catalyzed by proteinoids or RNA inside microspheres. When template-based protein molecules replaced the proteinoid inside the microspheres, a protein-based self-catalyzed network of chemical reactions could take place. It is plausible if Fox’s proteinoids microspheres is to dawn on a dissipative structure, then molecule selection could occur spontaneously by “dissipative” proteinoids, and the microspheres would acquire catalytic activity due to preserved the proteinoid with a large molecular weight and relatively complex and ordered multi-space structure, and relatively high catalytic activity. Thus the microspheres would spontaneously go to self-organizing, and evolve into primitive life.

In this paper, an icosahedral non – body centered model to simulate the periodic structure of homogeneous particulate composites, by predicting the particle arrangement, is presented. This model has yielded three different variations which correspond at three different deterministic particle configurations. In addition, the concept of boundary interphase between matrix and inclusions was taken into account. Thus, the influence of particle vicinity was examined in parallel with the interphase concept on the thermomechanical properties of the overall material. Next, by the use of this model the authors derived a closed – form expression to estimate the thermal conductivity of this type of composites. To test the validity of the model, the theoretical values arising from the proposed formula were compared with other theoretical predictions obtained from several accurate formulae found in the literature and an adequate accordance was observed.

Tsygankoite, ideally Mn8Tl8Hg2(Sb21Pb2Tl)Σ24S48, is a new sulfosalt discovered at the Vorontsovskoe gold deposit, Northern Urals, Russia. It occurs as lath-like elongated crystals up to 0.2 mm embedded in calcite-dolomite-clinochlore matrix. The associating minerals also include aktashite, alabandite, arsenopyrite, barite, cinnabar, fluorapatite, orpiment, pyrite, realgar, routhierite, sphalerite, tilasite, titanite, etc. The new mineral is non-fluorescent, black, opaque with a metallic lustre and black streak. It is brittle with an uneven fracture and no obvious parting and cleavage. Its Vickers hardness (VHN10) is 144 kg/mm2 (range 131–167) and its calculated density is 5.450 g cm-3. In reflected light tsygankoite is white; between crossed polars it is dark-grey to black. It is strongly anisotropic: rotation tints vary from light-grey to dark-grey to black. Pleochroism and internal reflections are not observed. The chemical composition of tsygankoite (wt.%, electron-microprobe data) is: Mn 6.29, Fe 0.02, Cu 0.02, Ag 0.01, Hg 5.42, Tl 26.05, Pb 5.84, As 3.39, Sb 30.89, S 21.87, Se 0.01, total 99.81. The empirical formula, calculated on the basis of 90 atoms pfu, is: Mn8.06Tl8.00(Hg1.90Fe0.03Cu0.02Ag0.01)Σ1.96(Sb17.85As3.18Pb1.98Tl0.97)Σ23.98(S48.00Se0.01)Σ48.01. Tsygankoite is monoclinic, space group C2/m, a = 21.362(4) Å, b = 3.8579(10) Å, c = 27.135(4) Å, β= 106.944(14)°, V = 2139.19(17) Å3 and Z = 1. The five strongest diffraction peaks from X-ray powder pattern [listed as (d,Å(I)(hkl)] are: 3.587(100)(112), 3.353(70)(-114), 3.204(88)(405), 2.841(72)(-513) and 2.786(99)(-514). The crystal structure of tsygankoite was refined from single-crystal X-ray diffraction data to R = 0.0607 and consists of an alternation of two thick layer-like arrays, one based on PbS-archetype and second – on SnS-archetype. Tsygankoite has been approved by the IMA-CNMNC under the number 2017-088. It is named for Mikhail V. Tsyganko, mineral collector from Northern Urals, who collected the samples where the new mineral was discovered.

A class $\mathfrak{M}$ $$ of coarse spaces is called a variety if $\mathfrak{M}$ $$ is closed under formation of subspaces, coarse images and products. We classify the varieties of coarse spaces and, in particular, show that if a variety $\mathfrak{M}$ $$ contains an unbounded metric space then $\mathfrak{M}$ is the variety of all coarse spaces.

A class $\mathfrak{M}$ $$ of coarse spaces is called a variety if $\mathfrak{M}$ $$ is closed under formation of subspaces, coarse images and products. We classify the varieties of coarse spaces and, in particular, show that if a variety $\mathfrak{M}$ $$ contains an unbounded metric space then $\mathfrak{M}$ is the variety of all coarse spaces.

In this paper, a geometric body-centered model to simulate the periodic structure of unidirectional fibrous composites is presented. To this end, three prescribed configurations are introduced to predict in a deterministic manner the arrangement of internal and neighboring fibers inside the matrix. Thus, three different representative volume elements (RVEs) are established. Furthermore, the concept of the interphase has been taken into account, stating that each individual fiber is encircled by a thin layer of variable thermomechanical properties. Next, these three unit cells are transformed in a unified manner to a coaxial multilayer cylinder model. This advanced model includes the influence of fiber contiguity in parallel with the interphase concept on the thermomechanical properties of the overall material. Then, by the use of this model, the authors propose explicit expressions to evaluate the longitudinal and transverse thermal conductivity of this type of composite. The theoretical predictions were compared with experimental results, as well as with theoretical values yielded by some reliable formulae derived from other workers, and a reasonable agreement was found.

In the work, the nuclei structure was modeled by a system of shells consisting of combinations of spherical and annular vortices. Having connected the spin and the magnetic moments of the nuclei with the dynamics of the outer shell of the nucleus, we determined its type and carried out a semiempirical calculation of the parameters of its structure for stable and unstable nuclear isotopes in the sequence of the order number Z from 1 to 37. Comparison of the obtained nuclear sizes with the radii of the electron shells of atoms made it possible to reveal a definite correlation. On the basis of it, it was concluded that the periodic law of Mendeleyev can determine the patterns in the change in the structure of the atomic nucleus.

In this work, we investigated the effects of heat treatment on the microstructure, hydrogen storage characteristics and corrosion rate of a Ti₃₄V₄₀Cr₂₄Fe₂ alloy. The arc melted alloy was divided into three samples, two of which were separately quartz-sealed under vacuum and heated to 1000 °C for 1 h; one of these samples was quenched and the other furnace cooled to ambient temperature. The crystal structures of the samples were studied via X-ray diffractometry and scanning electron microscopy. Absorption/desorption characteristics were investigated using a Sievert apparatus. Potentiostat corrosion tests on the alloys were performed using an AutoLab^® corrosion test apparatus and electrochemical cell. All samples exhibited a mixture of body-center-cubic (BCC) and Laves phase structures. The corrosion rate, maximum absorption, and useful capacities increased after both heat treatments. The annealed sample had the highest absorption and reversible capacity. The plateau pressure of the as-cast alloy increased after quenching. The corrosion rate increased from 0.0004 mm/y in as-cast sample to 0.0009 mm/y after annealing and 0.0017 mm/y after quenching, due to a decrease in the Cr-content of the C14 phase.

Traditional potential transformers have problems of large volume, difficulty in insulation, iron core saturation, ferroresonance overvoltage and poor transient response characteristics. The voltage sensor based on the principle of electric field coupling and differential input structure does not need to contact the measured object or ground, and can avoid the above problems. However, it requires a sufficiently high capacitance between the differential electrodes to obtain sufficient accuracy and a high voltage division ratio. The existing method of using mutual capacitance between the differential electrodes will cause many problems and fail to meet the practical needs. To solve the above problems, this paper innovatively uses multi-layer ceramic capacitor to replace the mutual capacitance and designs a new type of voltage sensor. In addition, by using single bypass small resistance grounding method to increase the input impedance of the differential signal processing circuit, error of the sensor is further reduced. The experimental results show that the sensor has excellent accuracy and great transient response characteristics. The ratio error under power frequency is within ±0.5% and the phase error is within 1. The ratio error in the range of 500 Hz∼30 kHz is within ±5% and the phase error is within 5. Moreover, it has the advantages of low cost, miniaturization, flexible shape and easy to adjust the voltage division ratio. These characteristics indicate that the sensor has good voltage measurement and sensor network potential.

Intercropping systems can flexibly use resources such as sunlight, heat, water, and nutrients in time and space, improve crop yield and land utilization rates, effectively reduce continuous cropping obstacles and the occurrence of diseases and insect pests, and control the growth of weeds. Thus, intercropping is a safe and efficient ecological planting mode. The legume–cereal intercropping system is the most common planting combination. Legume crops fix nitrogen from the atmosphere through their symbiotic nitrogen fixation abilities, and the fixed nitrogen can be transferred to and utilized by cereal crops in various ways. The symbiotic nitrogen fixation efficiency of legume crops was improved by reducing the inhibition of soil nitrogen on nitrogenase activity through competitive absorption of soil nitrogen. However, the effects of nitrogen transformation and distribution in intercropping systems, and microbial community structure characteristics on nitrogen transfer need to be further explored. In this review, ⅰ) we present the transformation and distribution of nitrogen in the legume–cereal intercropping system; ⅱ) we describe the soil microbial community characteristics in intercropping systems; and ⅲ) we discuss the advantages of using modern biological molecular techniques to study soil microorganisms. We conclude that intercropping can increase the diversity of soil microorganisms, and the interaction between different plants has an important impact on the diversity and composition of the bacterial and fungal communities. The extensive application of modern biological molecular techniques in soil microbial research and the great contribution of intercropping systems to sustainable agriculture are particularly emphasized in this review.

Studies of Phytophthora impacts in forests generally focus on individual species without recogni-tion that Phytophthora occur in multispecies communities. We investigated community structure of Phytophthora species in the rhizosphere of Agathis australis (kauri) in Te Wao Nui o Tiriwa / Waitākere Ranges, New Zealand, in the context of kauri dieback disease expression. Soil sampling and tree health monitoring was conducted on 767 randomly selected mature kauri trees. Phy-tophthora species were detected using both soil baiting and DNA metabarcoding of eDNA. Four species were detected with soil baiting (P. agathidicida, P. cinnamomi, P. multivora, and P. pseudo-cryptogea) and an additional three species with metabarcoding (P. kernoviae, P. cactorum/P. aleatoria and an unknown clade 7 species). Phytophthora cinnamomi was the most abundant species and was distributed throughout the forest. Both P. multivora and P. agathidicida were limited to forest edges, suggesting more recent arrivals. P. agathidicida presence was strongly correlated with declining canopy health, confirming its role as the main river of kauri dieback. The limited distribution of P. agathidicida and infrequent detections (11.0% samples) suggests that that this species is spreading as an introduced invasive pathogen and provide hope that with strategic management uninfected areas of the forest can be protected. The frequent detections of P.cinnamomi and P. multivora, from symptomatic trees in the absence of P. agathidicida suggest more research is needed to understand their roles in kauri forest health.

Apis cerana and Apis mellifera, are very important honey species for agriculture in Asian countries. In recent decades, A. cerana populations have sharply declined in all Asian countries as a result of Sacbrood Virus infection and have now recovered to their original size. It can change the genetic structure of local populations of A. cerana. We used the nuclear gene Vitellogenin VG to assess the genetic structure of local populations of A. cerana and the signature of adaptive selection. We performed a population genetic analysis of the honey bees A. cerana from South Korea in comparison with A. cerana samples from Russia, Japan, Nepal, and China. The sequences of the gene VG of a closely related honey bee species, A. mellifera, from India and Poland were used as outgroup samples. A comparative analysis of northern and southern A. cerana populations was performed. The signatures of positive adaptive selection were found in the local population of A. cerana. We performed the Tajima's neutrality D test for A. cerana populations from different local populations based on the gene VG exon sequences. All A. cerana populations showed signs of population size expansion following the possible recent decline in population sizes. The local populations of A. c. koreana were subdivided according to their geographical distribution into southern, northern, and central Korean clusters. The gene VG exon sequences can be used as informative markers for monitoring the changes in genetic structure and adaptation to the environment processes in A. cerana populations.

A survey of the trends in metal-ligand coordination and hydrogen bonding has been carried out on complexes of singly deprotonated cyanuric acid CY− and alkaline earth metals, synthesised from aqueous solution and characterised by X-ray crystallography. Involvement of cyanurate in the metal coordination increases from Mg through Ca and Sr to Ba relative to coordination by water, in parallel with the increasing ionic radius and coordination number. The incidence of bridging of metal centres by both water and cyanurate also increases in this series. The Mg complex contains hexaaqua-coordinated cations, uncoordinated CY− anions, and additional water molecules. Ca and Sr complexes feature polymeric chains of coordinated metal ions, the Ca complex with uncoordinated anions and the Sr complex with all potential ligands coordinated. The Ba complex has a two-dimensional coordination network. Extensive hydrogen bonding plays a key role in generating a three-dimensional network in all four structures. The competition between cyanurate and water for coordination to the alkaline earth metal cations, and that between coordination and hydrogen bonding propensities of the cyanurate anion, appear to be finely balanced, with the structural outcomes depending on the relative sizes and degrees of hardness of the four cations of the group.

Experimental measurement of porous polypropylene (PP) using the DTC-25 TA laboratory equipment and hot box test has been compared. The thermal conductivity of materials indicates the insulation capability of building materials. Excellent building materials will have a lower thermal conductivities value as well as other building insulator performance metrics. While results show that increasing the volume fraction of fluid in the porous PP has an inverse association with the thermal conductivity of the material as predicted by porous media theories, there is a marked difference in the measured values of the thermal conductivity using the two methods. The thermal conductivity values of porous from DTC-25 and hot box test were 0.21 and 0.0033 W/mK, respectively. The difference in the thermal conductivity values was due to the misapplication of the Fourier’s guarded heat flow model in the DTC-25 device to a convective fluid porous medium material.

For many decades, X-ray diffraction (XRD) has been used for material characterization. With the recent development in material science understanding and technology, various new materials are being developed, which requires upgrading the existing analytical techniques such that intricate problems can be solved. Although, XRD is a well-established non-destructive technique, it still requires further improvements in its characterization capabilities, especially when dealing with complex mineral structures. The present review conducts comprehensive discussions on atomic crystal structure, XRD principle, its applications, uncertainty during XRD analysis, and required safety precautions, all in one place. It further discusses the future research directions, especially the use of artificial intelligence and machine learning tools for improving the effectiveness and accuracy of XRD technique for mineral characterization. It has been focused that how XRD patterns can be utilized for a thorough understanding of the crystalline structure, size, and orientation, dislocation density, phase identification, quantification, and transformation, information about lattice parameters, residual stress, and strain, and thermal expansion coefficient of materials. All these important discussions on XRD for mineral characterization are compiled in this short yet comprehensive review that would benefit specialists and engineers in the chemical, mining, iron, metallurgy, and steel industries.

Five years ago, the concept of addressed fiber Bragg structures (AFBS) was proposed, which simultaneously perform the functions of a two-frequency radiation shaper, the difference frequency of which is the AFBS address, and a sensitive element, since the value of the difference frequency is invariant to measured physical fields, and the set of difference frequencies, moreover, is orthogonal in the array of such sensors, enabling their address multiplexing. In this article, we provide an overview of the theory and technology of AFBS, including the structures with three or more spectral components with various combinations of difference frequencies, symmetrical and asymmetric, performing the functions of the address and converting information signals to the low-frequency range at the same time, along with other functions. The subjects of interrogation of these structures, their fabrication and calibration are discussed as well. We also consider a wide range of applications in which AFBS can be used, covering such areas as oil and gas production, power engineering, transport, medicine, etc. In addition, the prospects of AFBS further development are proposed.

The crystal structure of a polymorph of Glycyl-L-alanine HI.H2O was synthesized from chiral cyclic Glycyl-L-alanine dipeptide, known to show molecular flexibility in different environments. The space group is polar (P21) and therefore pyroelectricity and optical second harmonic generation properties are allowed by symmetry. We report a pyroelectric coefficient as high as 45 µC/m2K occurring at 345 K, one order of magnitude smaller than the semi-organic ferroelectric Triglycine Sulphate (TGS) crystal. Furthermore, the polymorph displays a nonlinear optical effective coefficient of 0.14 pm/V, around 14 times smaller than the value from a phase-matched inorganic Barium Borate (BBO) single crystal.

The article presents a new approach to the analysis of the stability of automatic systems with discrete links.In almost all modern automatic control systems, there are links that break signals in time. These are power controlled switches - transistors or thyristors operating in a pulsed mode and digital links in regulators.Time discretization significantly affects the stability of processes in the automatic control system. The theoretical analysis of such systems is rather complicated and requires a significant change in engineering approaches to analysis. In connection with the improvement of digital controllers and a significant increase in their performance, in recent years this problem has practically not been remembered. However, its mathematical "content" has not changed since the 80s of the 20th century, when discreteness began to play a major role among the problems hindering progress in automatic control systems, in terms of the transition to digital systems.In this paper, a new approach is proposed, which consists in interpreting the sampling operation by a link with the proposed frequency characteristic, which determines the suppression of input high-frequency signals. This link greatly simplifies engineering calculations and demonstrates the new capabilities of sampling systems. These possibilities include the rational distribution of digitalization resources - the number of bits and the sampling interval between the regulator channels, depending on the frequency range of the efficiency of these channels. Theoretical statements have been verified and confirmed by simulation. It is shown how this approach makes it possible to formulate new principles of construction of seemingly well-known controllers - PID controllers and variable structure systems (VSS).

The subtropical forest soil plays a pivotal role in terrestrial carbon (C) cycling. Although global warming is expected to influence subtropical soil C cycling, a consensus on its impact on soil C dynamics remains elusive. Given the significant response of soil microbial respiration to temperature in subtropical soils, understanding its behavior under varying temperature regimes is critical for predicting soil organic C (SOC) responses to climate warming. We conducted a short-term laboratory soil warming incubation experiment, sampling both warmed and un-warmed soils from a subtropical plantation in southeastern China, incubating them at 20 °C, 30 °C, and 40 °C. Our aim was to study the SOC mineralization response to increasing temperatures. Our findings revealed that the temperature sensitivity (Q10) of SOC mineralization to short-term experimental warming varied between the warmed soil and the un-warmed soil. The Q10 of the un-warmed soil escalated with the temperature treatment (20-30 ℃: 1.31, 30-40℃: 1.63). Conversely, the Q10 of the warmed soil decreased (20-30 ℃:1.57, 30-40 ℃:1.41). Increasing temperature treatments enhanced hydrolytic enzyme activity but decreased soil substrate availability in both un-warmed and warmed soil. The Q10 of un-warmed soil was positively correlated with the response ratio of DOC. Additionally, soil microbial biomass exhibited a significant decline, leading to a reduced total amount of PLFAs and a decreased abundance of bacteria, fungi, and Gram-negative bacteria (GN). The changes in temperature also considerably altered the composition of the warmed soil microbial community. A drop in the microbial quotient coupled with a rise in the metabolic quotient indicated that warming amplified microbial respiration over microbial growth. The differential Q10 of SOC mineralization, in response to temperature across varying soil, can largely be attributed to shifts in soil nutrients, C-degrading enzyme activities, and microbial communities (the ratio of fungal to bacterial PLFAs).

Cu-Sn shape-memory microwires were fabricated by a glass-coated melt spinning method. Effects of Sn content on the microstructure and mechanical property of microwires were investigated. The phase transforms from martensite to austenite with Sn content increasing from 14.0 atomic percent (at.%) to 16.5 at.%, and highly ordered intermetallic phase, δ, formed with higher Sn content. The fracture stress, σf, and the critical stress for martensitic transformation, σMs, increases with Sn content increasing. The mechanical property as well as superelasticity were improved greatly by high cooling rate of the glass-coated melt spinning method.

In this study we discuss critical issues in modelling the structure and function of lymph nodes (LNs), with emphasis on how LN physiology is related to its multi-scale structural organization. In addition to macroscopic domains such as B-cell follicles and the T cell zone, there are vascular networks which play a key role in the delivery of information to the inner parts of the LN, i.e., the conduit and blood microvascular networks. We propose object-oriented computational algorithms to model the 3D geometry of the fibroblastic reticular cell (FRC) network and the microvasculature. Assuming that a conduit cylinder is densely packed with collagen fibers, the computational flow study predicted that the diffusion should be a dominating process in mass transport than convective flow. The geometry models are used to analyze the lymph flow properties through the conduit network in unperturbed- and damaged states of the LN. The analysis predicts that elimination of up to 60–90 % of edges is required to stop the lymph flux. This result suggests a high degree of functional robustness of the network.

The method of doublet frequency distance (DFD-) maps was applied, here, for visualization of DNA sequence structures of yeast chromosomes. The colour scale “rainbow” of the Octave programming tool is well suited for such visualization. The DFD-maps are generated by comparison of the differences in the number of all base doublets in a shifting frame with all other positions of this frame in a regarded DNA sequence section. This procedure can be applied from DNA-sections of between a few hundred bases (bps) up to a complete chromosome with a million or more bps. An orthogonal DFD-map pattern dominates all chromosomes and its parts. It can be interpreted by a large number of successive mutation events during evolution. In contrast, diagonal patterns indicate duplications of sequence sections and multiple tandem repeats. These periodic structures are found in several chromosomes and are more or less regular or noised. The larger tandem repeat in the subtelomeric region of chromosome 12 presents a characteristic example of a nested multiple-repeat structure. Its pattern in the DFD-map illustrates obviously a temporal order of duplication and mutation events leading to a hierarchical sequence architecture.

This article objectively assesses, the hypothesis of the streamline's shape theory and its formulated equation. The deduction of proof uses algebra rather than first-order partial differential equations to address the specific hypothesis of "Streamline's shape theory" from the fundamental perspective of applied mathematics and scientifically derives mathematical relations of the axioms and corollaries in the field of fluid dynamics. The algebraic methods employed provide progressively more distinct and precise solutions compared to first-order partial differential equations. The foremost objective of this work is to evaluate if the formulations of the streamline's shape theory can have solutions for inviscid-incompressible and viscid-compressible flows of Newtonian fluids and to identify their nature. Secondly, to understand how the topology of the body and the free-stream conditions affect these solutions with due regards to the shape and size of the body interacting with the fluid flow. Finally, to explore the possibility of this theory to develop a CFD solver for streamline simulation to reduce the experimentation in the analysis of flow-structure interactions of Newtonian fluids and also to identify its scope of applications and limitations.

The aim of this research is to expand recent developments in the mapping of pasture yield with remotely piloted aircraft systems to that of satellite-borne imagery. Up to date, spatially explicit and accurate information of the pasture resource base is needed for improved climate-adapted livestock rangeland grazing. This study developed deep learning predictive models of pasture yield, as total standing dry matter in tonnes per hectare (TSDM(tha−1)), from field measurements and both remotely piloted aircraft systems and satellite imagery. Repeated remotely piloted aircraft system structure measurements derived from structure from motion photogrammetry, provided measures of pasture biomass from many overlapping high-resolution images. Repeated remotely piloted aircraft system measures throughout a growing season, were modelled with persistent photosynthetic pasture responses from various Planet Dove high spatial resolution satellite image-derived vegetation indices. Pasture height modelling as an input to the modelling of yield was assessed against terrestrial laser scanning and reported correlation coefficients (R2) from 0.3 to 0.8 for both a coastal grassland and inland woodland pasture. Accuracy of the predictive modelling from both the remotely piloted aircraft system and the Planet Dove satellite image estimates of pasture yield ranged from 0.8 to 1.8 TSDM(tha−1). These results indicated that the practical application of repeated remotely piloted aircraft system derived measures of pasture yield can, with some limitations, be scaled-up to satellite-borne imagery to provide more temporally and spatially explicit measures of the pasture resource base.

A new model of cosmology is proposed, where the state of high energy density commonly associated with the big bang is generated by the collapse of an antineutrino star that has exceeded its Chandrasekhar limit. To allow the first neutrino stars and antineutrino stars to form naturally from an initial quantum vacuum state, matter and antimatter are assumed to gravitationally repel. In this scenario, a degenerate antineutrino star in effective hydrostatic equilibrium has a density that is similar to the dark energy density of the ΛCDM model. When viewed from the core, such a star could today accelerate matter radially and emit the isothermal cosmic microwave background radiation, which addresses the horizon and flatness problems. This model and the ΛCDM model are in similar quantitative agreement with supernova distance measurements. The presented model is also in qualitative agreement with observed large-scale anisotropy and inhomogeneity, which distinguishes it from the ΛCDM model.

An in vitro medium-throughput screen using M. tuberculosis H37Rv was employed to screen an in-house library of structurally diverse compounds for antimycobacterial activity. From this initial screen, eleven 7-substituted coumarin derivatives with confirmed monoamine oxidase-B and cholinesterase inhibitory activities, demonstrated growth inhibition of more than 50% at a 50 µM concentration. This prompted further exploration of all the 7-substituted coumarins in our library, nineteen in total, as potential antimycobacterial agents. Four derivatives showed promising antimycobacterial activity with MIC₉₉ values of 8.31 – 29.70 µM and 44.15 – 57.17 µM on M. tuberculosis H37Rv in independent assays using Gaste-Fe and 7H9 + OADC media, respectively. These compounds were found to bind to albumin which may explain the variations in MIC between the two assays. Preliminary antimycobacterial evaluation of moxifloxacin resistant M. tuberculosis show that these compounds are able to maintain their activity in fluoroquinolone resistant mycobacteria. Analysis of structure activity relationships for antimycobacterial versus neuronal enzyme inhibitory activity indicate that structural modification on position 4 and/or 7 of the coumarin scaffold may be utilized to improve selectivity towards either inhibition of neuronal enzymes or antimycobacterial effect. Cytotoxicity evaluations of the compounds indicate moderate cytotoxicity with slight selectivity towards mycobacteria. Further neuroprotective assays on SH-SY5Y human neuroblastoma cells indicate significant neuroprotection for selected compounds irrespective of their neuronal enzyme inhibitory properties. These coumarin molecules are thus interesting lead compounds that may provide insight into the design of new antimicrobacterial and/or neuroprotective agents.

Micro elastofluidics is a transformative branch of microfluidics, leveraging fluid-structure interaction (FSI) at the microscale to enhance the functionality and efficiency of various microdevices. This review paper elucidates the critical role of advanced computational FSI methods in the field of micro elastofluidics. By focusing on the interplay between fluid mechanics and structural responses, these computational methods facilitate the intricate design and optimisation of microdevices such as microvalves, micropumps, and micromixers, which rely on the precise control of fluidic and structural dynamics. In addition, these computational tools extend to the development of biomedical devices, enabling precise particle manipulation and enhancing therapeutic outcomes in cardiovascular applications. Furthermore, this paper addresses the current challenges in computational FSI and highlights the necessity for further development of tools to tackle complex, time-dependent models under microfluidic environments and varying conditions. Our review highlights the expanding potential of FSI in micro elastofluidics, offering a roadmap for future research and development in this promising area.

Thermal expansion of four alkaline-earth borates, namely Ca3B2O6 (0D), CaB2O4 (1D), Sr3B14O24 (2D) and CaB4O7 (3D), have been studied by in situ high-temperature powder X-ray diffraction (HTXRD). Strong anisotropy of thermal expansion is observed for the structures of Ca3B2O6 (0D) and CaB2O4 (1D) built up from BO3 triangles only: these borates exhibit the maximal expansion perpendicular to the BO3 plane, i.e. along the direction of weaker bonding in the crystal structure. Layered Sr3B14O24 (2D) and framework CaB4O7 (3D) built up from various B-O groups expand less anisotropically. Thermal properties of the studied compounds compared to the other alka-line-earth borates are summarized depending on the selected structural characteristics like anion dimensionality, residual charge per one polyhedron (BO3 BO4), cationic size, and structural com-plexity. For the first time these dependencies were established as an average for both types of polyhedra (triangle and tetrahedron) occurring in the same structure at the same time. The most common trends were identified for : (i) Melting temperature decreases as the dimensionality of the borate polyanion, and more precisely, as the residual charge per one polyhedron (triangle or tetrahedron) decreases; (ii) volumetric expansion decreases while the degree of anisotropy in-creases weakly when the residual charge decreases; (iii)both trends (i) and (ii) are most steady within borates built by the triangles only, while the borates built by both triangles and tetrahedra show a larger scatter in values.

(S)-1-Methyl-2-oxoimidazolidine-4-carboxylic acid 1 is an analog of (S)-pyroglutamic acid, a key component of naturally occurring peptide hormones and synthetic pharmaceutical candidates. Reaction of (S)-2-amino-3-(methylamino)propionic acid with COCl2 and aqueous NaHCO3 followed by ion exchange afforded 1, which was recrystallized from acetonitrile and then characterized by IR, 1H NMR, 13C NMR, polarimetry, elemental microanalysis, high resolution mass spectrometry and single crystal X-ray diffraction. The acid 1 crystallized in the orthorhombic chiral space group P212121 with cell constants a = 6.2275(4) Å, b = 8.3963(5) Å, c = 24.9490(14) Å. The X-ray crystal structure reveals that two distinct conformers of 1 occur at alternating positions within helices which are supported by hydrogen-bonding. Each molecule of 1 is linked to its two neighbors in the helix by a total of three hydrogen bonds and four molecules of 1 are contained within each turn of the helix. The pattern of hydrogen bonds illustrates a preference for the carboxylic acid group to act as a hydrogen bond donor and for the urea unit to be a hydrogen bond acceptor.

This paper explores the application of Random Matrix Theory (RMT) as a methodological enhancement for portfolio selection within financial markets. Traditional approaches to portfolio optimization often rely on historical estimates of correlation matrices, particularly susceptible to instability. To address this challenge, we combine a data preprocessing technique based on the Hilbert transformation of returns with RMT to refine the accuracy and robustness of correlation matrix estimation. By contrasting empirical correlations with those derived from random matrices, we uncover non-random properties and underlying relationships within financial data. We then utilize this methodology to construct the correlation network dependence structure used in portfolio optimization. The empirical analysis presented in this paper validates the effectiveness of RMT in enhancing portfolio diversification and risk management strategies. This research contributes by offering investors and portfolio managers with methodological insights to construct portfolios that are more stable, robust, and diversified. At the same time, it advances our comprehension of the intricate statistical principles underlying multivariate financial data.

This paper delves into the application of digital twin monitoring techniques for enhancing offshore floating wind turbine performance, with a detailed case study. We explore the practical implementation of digital twins and their efficacy in optimizing operations and predictive maintenance. Our findings emphasize digital twins' potential as a valuable tool for renewable energy, driving efficiency and sustainability in offshore floating wind installations.

While the underwater submersible encounters internal solitary wave (ISW), its loadings and motions would be seriously disturbed. To investigate the interaction effect between the suspended submersible and ISW, a three dimensional ISW-submersible interaction numerical model was established based on the Computational Fluid Dynamics (CFD) method. The generation and propagation of ISW was simulated in a two-layer fluid numerical wave tank according to the eKdV theory. The standard operation equation of submersible was introduced to simulate the six degree of freedom (6DoF) motions of submersible combined with the overset dynamic mesh method. The motion simulation method of submersible was effectively validated by comparing with published experimental results on the motion responses of the slender body under the ISW. Based on the constructed numerical model, the dynamic mechanism between the suspended submersible and ISW were studied, and the effects of the initial submerged depths and the ISW amplitudes on the dynamic responses of the submersible were revealed. According to the numerical results, the motions of the submersible have been significantly determined by its initial submerged depths. The submersible located above the ISW interface has a significant motion along the propagation direction of ISW and its motion trajectory resembles a counterclockwise semi ellipse. The motions of the submersible located below the ISW interface follows with the trace of the lower layer fluid which presented as an unclosed clockwise ellipse. The corresponding motions of the submersible would be increased as the increase of the ISW amplitudes.

A novel process design for damage-free and highly accurate positional integration of an optical multi-axial force sensor into a hollow tube by means of rotary swaging is introduced. Numerical simulations reveal relevant process phenomena of thin disc joining inside a pre-toothed hollow tube and help to find an optimal process design. Experimental trials show a significant effect of axial material flow and the number of tools in a rotary swaging process. By taking these effects into account, a successful form- and force-fit joining of the sensor carrying discs into the tube can be achieved. A successful joining of an optical sensor for bending forces and torque measurement shows hysteresis-free sensory behavior and thus backlash-free joining of the sensor carrier discs. The paper finishes with presenting an approach for closed-loop position controlling during the joining process and numerically investigation of the process design.

To improve the adaptability of aerial reflective opto-mechanical structures to low-temperature environments, an optimized thermal control design is proposed. Firstly, the relationship be-tween conventional heating methods and axial/radial temperature differences of mirrors with different shapes is analyzed. Based on heat transfer analyses, it is pointed out that optimized thermal control design is necessary to ensure the temperature uniformity of the fused silica mirror and take into account the temperature level when working in low temperature environ-ments. A thermal control scheme based on temperature negative feedback variable power zone heating is proposed for the characteristics of aerial electro-optics systems. Using the thermal control scheme at low temperatures ensures that the average temperature of the mirror fluctu-ates slowly and slightly around 20℃. At the same time, the temperature differences within a mirror and between the primary mirror and the secondary mirror can be controlled within 5℃. Thereby, satisfactory image quality is obtained.

The main development direction of energy efficiency technologies in construction is the creation of various materials with a complex structure and unique strength, thermal and other properties. The aerogel is a material with high porosity and excellent thermal insulation properties. This paper provides the state-of-the-art of aerogel applications for the additive manufacturing of energy efficient buildings. This work provides the experimental and numerical assessment results of thermal conductivity of aerogel-enhanced blanket, the experimental assessment results of thermal performance of aerogel-enhanced building structure, the experimental assessment results of the aerogel application as mixture powder component of the concrete mixture to printing building and the experimental assessment results of the aerogel application as parget powder component. Experimental results show the effect of aerogel powder component application: thermal conductivity decreased by 25%.

Ceramic composites have good strength, fracture toughness and hardness characteristics and are widely used in industry, medicine. The properties of ceramic composites can be controlled at the production stage by setting the internal structure. This is made possible by the development of additive manufacturing. However, not all properties are well understood, especially dynamic fracture resistance and fracture toughness. In order to predict the mechanical behavior of ceramic composites in the manufacturing phase with a controlled structure under dynamic loads, it is convenient to use methods of numerical analysis. The aim of this work was to investigate the influence of loading speed and internal structure on dynamic resistance and fracture toughness of ATZ nanocomposites. Within the framework of the study physical and mathematical model that is used in computational mechanics of materials is developed. In the paper is shown the influence of the loading rate on the strain rate in the region of the shock transition for materials based on ZrO2 - Al2O3 system. The research shows nonlinear effects under intense dynamic loads in the shown composite materials are bound up with either the processes of self-organisation of deformation modes at the mesoscopic level or the occurrence of martensitic phase transformations in matrix volumes adjacent to the strengthening particles.

This article investigates on the radial and non-radial geodesic structures of the generalized K-essence Vaidya spacetime. Within the framework of K-essence geometry, it is important to note that the metric does not possess conformal equivalence to the conventional gravitational metric. This study employs a non-canonical action of the Dirac-Born-Infeld kind. In this work, we categorize the generalized K-essence Vaidya mass function into two distinct forms. Both the forms of the mass functions have been extensively utilized to analyze the radial and non-radial time-like or null geodesics in great details inside the comoving plane. Indications of the existence of wormhole can be noted during the extreme phases of spacetime, particularly in relation to black holes and white holes, which resemble the Einstein-Rosen bridge. In addition, we have also detected the distinctive indication of the quantum tunneling phenomenon around the central singularity.

Biological function depends on the composition as well as structure of the organism, that is the organization of interactions between its parts. In multicellular organisms, the complex communication between cells is crucial for the coordination of cellular functions (growth, differentiation, apoptosis), compartmentalization of cellular processes within the organism, and the integration of cells into functioning higher levels of structural organization. Here we focus on the interaction among cells, as the basic level of biological organization, capable of a remarkable degree of autonomy and self-maintenance. While a wealth of data on putative cell interactions has recently become available, its biological interpretation depends on expectations we have for the structure of these interaction networks. This contribution is an attempt at formulating basic questions we may ask about cell interaction data. We build on the understanding that cells fulfill two general functions: the integrity-maintaining and the organismal service function. We derive the expected patterns of cell interactions considering two intertwined aspects: the immediate functional and the evolutionary. Based on these, we propose several guidelines for analysis and interpretation of transcriptional cell-interactome data.

The crystallization conditions from the solution play an important role in determining the mor-phology, phase composition, and photovoltaic properties of perovskite films. Post-processing of the obtained films can have a crucial role in increasing the grain size of perovskite and enhancing its crystallinity. It has been shown that the formation of crystal nuclei can be utilized to accelerate crystallization. In this case, crystallization occurs through the growth of seed crystals created in the solution, enabling the formation of relatively large crystals. For the deposition of CH3NH3PbI3 hybrid halide perovskite films from a solution of the perovskite in dimethylformamide the spin coating echnique was employed. Pre-crystallization was achieved by heating films at a temperature of 100 or 110 °C. The dissolution process involved adding a drop of dimethylformamide onto the substrate surface and allowing it to partially dis-solve the perovskite for 30-40 seconds. Subsequently, residual solvent was removed through spin coating. The recrystallization process was carried out by heating films at the temperature range of 80 to 130 °C. The morphological analysis of the perovskite film surfaces after recrystallization at tem-peratures ranging from 80 to 130 °C was performed. The infrared transmission spectra of the obtained perovskite films were investigated, and their light absorption characteristics were studied through transmission spectra. The perovskite structure in the obtained films was con-firmed by the peaks observed in the X-ray diffraction patterns.

Parametric form findings of free-form space structures and qualitative assessment of their aesthetics are among the concerns of architects. This study aims to evaluate the aesthetic aspect of these structures using ML algorithms based on the expert's experiences. First, various datasets of forms were produced using a parametric algorithm of free-form space structures written in Grasshopper. Then, three multilayer perceptron ANN models were adjusted in their most optimal modes using the results of the preference test based on the aesthetic criteria including simplicity, complexity, and practicality. The results indicate that the ANN models can quantitatively evaluate the aesthetic value of free-form space structures.

In recent times, the soft robotics field is gaining numerous research focus owing to its high level of manipulation capabilities unlike traditional rigid robots, which gives room for an increasing use in other areas. However, compared to traditional rigid gripper robots, being capable of controlling/obtaining overall body stiffness when required is yet to be further explored since soft gripper robots have inherently less rigid properties. unlike previous designs with very complex variable stiffness systems, this paper demonstrates a soft gripper design with minimum system complexity while being capable of varying the stiffness of a continuum soft robotic actuator and proves to have potential applications in gripping objects of various shapes, weights & sizes. The soft gripper actuator comprises two separate mechanisms; the pneumatic mechanism for bending control and the mechanical structure for stiffness variation by pulling tendons using stepper motors which compresses the actuator, thereby changing the overall stiffness. The pneumatic mechanism was first fabricated and then embedded into another silicon layer during which it was as well merged with the mechanical structure for stiffness control. By first pneumatically actuating the actuator which causes bending and then pulling the tendons, we found out that the actuator stiffness value can be increased up to 145 % its initial value, and the gripper can grasp & lift a weight of up to 2.075 kg.

This study aims to investigate the spectroscopic and structural properties of the compound Lumefantrine which is important in pharmacology because of its anti-malarial effect. The structural and spectroscopic properties of this molecule such as bond lengths, bond angles, FT-IR and NMR spectra were handled computationally using a computational chemistry suite: Spar-tan’14. Both HF and DFT methods were used with different basis sets for the calculations. The re-sults calculated by the software were compared to experimental results from the literature. Both Computational and experimental results were exhibited as tables. Also some calculated results such as HOMO-LUMO boundary orbitals and electrostatic potential map, were given as graphics and pictures.

Plant breeding aims to develop elite crop varieties appropriate for various environments with higher quality and quantity of production. Researchers use quantitative trait loci (QTL) mapping and association studies to identify regions in the genome responsible for the variation of the quantitative traits of interest. However, mapped regions do not always translate to functional proteins, which makes it challenging to identify genes associated with traits of interest. The biological functions of proteins are strongly dependent on their 3D structure. Alternatively, if proteins can be directly linked with the phenotypes, the effect of mutations on phenotypic changes can be assessed. Innovation of deep learning models in biology opens new avenues of exploration. AlphaFold is an AI system that predicts the 3D structure of a protein from its amino acid sequence with near experimental accuracy and was used in this study. Point mutations with a significant influence on the 3D structure of a protein can capture the effect on phenotypes through association study, and this provides insights into the regions that are of functional importance. In the current study, 534 plants were selected based on plant vigor, and 154 missense variants that change amino acid sequences, including 5 significant hits from previous study, were included. The changes in protein 3D structure were assessed by association with the phenotype. The analysis identified five significant associations, four of which were also identified in previous study of SNPs GWAS, however, a new fifth association was also identified which was annotated as disease resistance gene in Medicago truncatula. This study helps to associate SNPs that could be missed by GWAS due to stringent Bonferroni corrected p-values by providing a more robust filter for SNPs using features from predicted protein 3D structures.

Air pollution is an important factor affecting human health and daily life. Chinese government is making vigorous efforts to control air pollution. The upgrading of industrial structure is a problem-solving tool in environment and economic growth cases. This paper aims to explore the relationships among environmental regulation, the upgrading of industrial structure and air pollution. The PVAR (Panel Vector Auto Regression) model and moderation effect model has been used to conduct empirical analysis based on panel data of 30 provinces in China from 2004 to 2020. The results of analysis indicate (1) the environmental regulation can significantly reduce the air pollution, but the deterioration of air quality could not effectively influence environmental regulations. (2) The upgrading of industrial structure can weaken the air pollution and air pollution hinders the upgrading of industrial structure. (3) With the improvement of environmental regulation, the industrial structure is constantly upgraded, but the upgrading of the industrial structure has a negative effect on the improvement of environmental regulation. (4) The upgrading of industrial structure can positively moderate the influence of environmental regulation on air pollution.

Since the early 21st century, the globalization trend and technological innovations have changed the ways and speed of market growth. Rapid market expansion and the pressure for firms to achieve sustainable business growth via mergers and acquisitions have become the norms for acquiring the necessary competencies, expanding market shares and business integrations. This study explains the factors that correlate to the IJM's financial performance based on the market dynamics in recent years. This case study is a qualitative approach employing systematic review and content analysis. As a result, firms begin to diversify or venture into the business segments that might be related to or complement their core businesses, intentionally or unintentionally, which eventually evolved into the conglomerate form. This case study provides a financial performance analysis of IJM Corporation Berhad's success and challenges from its conglomerate business model. The fact that a well-diversified firm will have better risk management in the event of an economic downturn is also a primary driver for firms to embark on a corporate diversification strategy. This case study reveals IJM's conglomerate model has been successful during its rapid business growth; however, it has shown signs of diminishing in recent years.

The discovery of first ATP-binding cassette (ABC) transporter, whose overexpression in cancer cells is responsible for exporting anticancer drugs out of tumor cells, initiated enormous efforts to overcome tumor cell multidrug resistance (MDR) by inhibition of ABC-transporter. Because of its many physiological functions, diverse studies have been conducted on the mechanism, function and regulation of this important group of transmembrane transport proteins. In this review, we will focus on the structural aspects of this transporter superfamily. Since the resolution revolution of electron microscope, experimentally solved structures increased rapidly. A summary of the structures available and an overview of recent structure-based studies are provided. More specifically, the artificial intelligence (AI)-based predictions from AlphaFold 2 will be discussed.

Weaving technology can convert two-dimensional structures such as ribbons into three-dimensional structures by specific connections. However, most of the 3D structures fabricated by conventional weaving methods using straight ribbons have some topological defects. In order to obtain smoother continuous 3D surface structures, Baek et al. proposed a novel weaving method using naturally curved (in-plane) ribbons to fabricated three-dimensional curved structures and using this method to weave new spherical weave structures that are closer to perfect spheres. We believe that this new spherical weave structure with smooth geometric properties must correspond to new mechanical properties. To this end, we investigated the buckling characteristics of different types of spherical weave structures by the combination of test and finite element method. The results of calculations and experiments show that the failure mode of the spherical weave structure under vertical loading can be divided into two stages: a flat contact region forms between the spherical weave structure and the rigid plate and inward dimple of ribbons. The spherical weave structures using naturally curved (in-plane) ribbon weaving have better buckling stability than those woven with straight ribbons. The vertical buckling load of spherical weave structures using naturally curved ribbon increases with the width and thickness of the ribbon. In addition, this paper combines test, theoretical and finite element analysis to propose the buckling load equation and buckling correction factor equation for the new spherical weave structure under vertical compression load.

Weaving is an ancient and effective structural forming technique characterized by the ability to convert two-dimensional ribbons to three-dimensional structures. However, most 3D structures woven from straight ribbons have topological defects. Baek et al. proposed a method to weave smoother continuous 3D surface structures using naturally curved (in-plane) ribbons, obtained a new surface structure with relatively continuous variation of Gaussian curvature, and analyzed its geometric properties. We believe that this new 3D surface structure with smooth geometric properties must correspond to new mechanical properties. To this end, we investigated a 3D surface structure using naturally curved (in-plane) ribbon weaving, and the results of calculations and experiments show that such structures have better buckling stability than those woven with straight ribbons. It is observed that the number of ribbons influences the buckling behavior of different types of woven structures.

The late universe contains a wealth of information about fundamental physics and gravity, wrapped up in non-Gaussian fields. To make use of as much information as possible it is necessary to go beyond two-point statistics. Rather than going to higher order N-point correlation functions, we demonstrate that the probability distribution function (PDF) of spheres in the matter field (a one-point function) already contains a significant amount of this non-Gaussian information. The matter PDF dissects different density environments which are lumped together in two-point statistics, making it particularly useful for probing modifications of gravity or expansion history. Our approach in Cataneo et. al. 2021 extends the success of Large Deviation Theory for predicting the matter PDF in ΛCDM in these “extended” cosmologies. A Fisher forecast demonstrates the information content in the matter PDF via constraints for a Euclid-like survey volume combining the 3D matter PDF with the 3D matter power spectrum. Adding the matter PDF halves the uncertainties on parameters in an evolving dark energy model, relative to the power spectrum alone. Additionally, the matter PDF contains enough non-linear information to substantially increase the detection significance of departures from General Relativity, with improvements up to six times the power spectrum alone. This analysis demonstrates that the matter PDF is a promising non-Gaussian statistic for extracting cosmological information, particularly for beyond ΛCDM models.

The aminoglycoside 6′-N-acetyltransferase type Ib [AAC(6′)-Ib] is a common cause of resistance to amikacin and other aminoglycosides in Gram-negatives. Utilization of mixture-based combinatorial libraries and application of the positional scanning strategy identified an inhibitor of AAC(6′)-Ib. This inhibitor’s chemical structure consists of a pyrrolidine pentamine scaffold substituted at four locations (R1, R3, R4, and R5). The substituents are two S-phenyl (R1 and R4), an S-hydroxymethyl (R3), and a 3-phenylbutyl (R5) groups. Another location, R2, does not have a substitution, but it is named because its stereochemistry was modified in some compounds utilized in this study. Structure-activity relationship (SAR) analysis using derivatives with different functionalities, modified stereochemistry, and truncations were carried out by assessing the effect of the addition of each compound at 8 µM to 16 µg/ml amikacin-containing media and performing checkerboard assays varying the concentrations of the inhibitor analogs and the antibiotic. The results showed that: 1) the aromatic functionalities at R1 and R4 are essential, but the stereochemistry is essential only at R4, 2) the stereochemical conformation at R2 is critical, 3) the hydroxyl moiety at R3 as well as stereoconformation are required for full inhibitory activity, 4) the phenyl functionality at R5 is not essential and can be replaced by aliphatic groups, 5) the location of the phenyl group on the butyl carbon chain at R5 is not essential, 6) the length of the aliphatic chain at R5 is not critical, 7) all truncations of the scaffold resulted in inactive compounds. Molecular docking revealed that all compounds preferentially bind to the kanamycin C binding cavity, and binding affinity correlates with the experimental data for most of the compounds evaluated. The SAR results in this study will serve as the basis for the design of new analogs in an effort to improve their ability to induce phenotypic conversion to susceptibility in amikacin-resistant pathogens.

The colossal depths of the deep neural network sometimes suffer from ineffective backpropagation of the gradients through all its depths. Whereas, The strong performance of shallower multilayer neural structures prove their ability to increase the gradient signals in the early stages of training which easily gets backpropagated for global loss corrections. Shallow neural structures are always a good starting point for encouraging the sturdy feature characteristics of the input. In this research, a shallow, deep neural structure called PrimeNet is proposed. PrimeNet is aimed to dynamically identify and encourage the quality visual indicators from the input to be used by the subsequent deep network layers and increase the gradient signals in the lower stages of the training pipeline. In addition to this, the layerwise training is performed with the help of locally generated errors which means the gradient is not backpropagated to previous layers, and the hidden layer weights are updated during the forward pass, making this structure a backpropagation free variant. PrimeNet has obtained state-of-the-art results on various image datasets, attaining the dual objective of (1) compact dynamic deep neural structure, which (2) eliminates the problem of backwards-locking. The PrimeNet unit is proposed as an alternative to traditional convolution and dense blocks for faster and memory-efficient training, outperforming previously reported results aimed at adaptive methods for parallel and multilayer deep neural systems.

In this paper we establish a topological framework of τ-structures to quantify the evolutionary transitions between two RNA sequence-structure pairs. τ-structures developed here consist of a pair of RNA secondary structures together with a non-crossing partial matching between the two backbones. The loop complex of a τ-structure captures the intersections of loops in both secondary structures. We compute the loop homology of τ-structures. We show that only the zeroth, first and second homology groups are free. In particular, we prove that the rank of the second homology group equals the number γ of certain arc-components in a τ-structure, and the rank of the first homology is given by γ−χ+1, where χ is the Euler characteristic of the loop complex.

Refraction of an oblique shock wave on a tangential discontinuity dividing two gas flows with different properties is considered. It is shown that its partial reflection occurs excepting of geometrical diffraction of an oblique shock. Another oblique shock, expansion wave or weak discontinuity that coincides with Mach line, can act as a reflected disturbance. This study focuses on relationships which define the type of reflected discontinuity and its parameters. Domains of existence of various shock-wave structures with reflected disturbances of two types and boundaries between them are defined. The domains of parameters with one or two solutions exist for the characteristic refraction. Conditions of the regular refraction and the Mach refraction are formulated, and boundaries between those two refraction types are defined for various types of gases. Refraction phenomena in various engineering problems (hydrocarbon gaseous fuel and its combustion products, diatomic gas, fuel mixture of oxygen and hydrogen etc.) are discussed.

During the 1970s, Tunisian durum wheat landraces were replaced progressively by modern cultivars. These landraces are nowadays maintained by smallholder farmers in some ecological niches and are threatened gradually by extinction resulting on the narrowing of the genetic diversity. This study aims to investigate patterns of phenotypic variability using twelve quantitative traits in a panel of 189 durum wheat landraces and seven checks, based on farmer’s population name attribution and genetic structure. Our results showed high phenotypic variability among and within landraces and checks for the majority of the studied traits. The principal components analysis showed similar grouping using farmers name attribution and genetic structure using K = 6, which confirmed the identification of a new gene pool in the oases of Tunisia, represented by the sub-population Jenah Zarzoura and the robustness and high relationships between phenotypic and genome-wide genetic structure using DArTseq method. These findings will enhance the conservation efforts of these landraces and their use in breeding efforts at national and international levels to adapt to dry conditions.

On the primitive Earth, both L- and D-amino acids would have been present. However, only L-amino acids are essential blocks to construct proteins in modern life. To study the relative stability of D-amino acid substituted peptides, a variety of computational methods were applied. Ten prebiotic amino acids (Gly, Ala, Asp, Glu, Ile, Leu, Pro, Ser, Thr, and Val) were previously determined by multiple meteorite, spark discharge, and hydrothermal vent studies. Some previously reported early Earth polypeptide analogs were focused on in this study. Tripeptides composed of only Asp, Ser, and Val exemplified that different positions (i.e., N-terminus, C-terminus, and middle) made a difference in the minimal folding energy of peptides, while the chemical classification of amino acid (hydrophobic, acidic, or hydroxylic) did not show a significant difference. Hierarchical cluster analysis for dipeptides with all possible combinations of the proposed ten prebiotic amino acids and their D-amino acid substituted derivatives generated five clusters. Primordial simple polypeptides were modeled to test the significance of molecular fluctuations, secondary structure occupancies, and folding energy differences based on these clusters. We found peptides with α-helices, long β-sheets, and long loops are usually less sensitive to D-amino acid replacements in comparison to short β-sheets. Intriguingly, amongst 129 D-amino acid residues, mutation sensitivity profiles presented that the ratio of more to less stable residues was about 1. In conclusion, some combinations of a mixture of L- and D-amino acids can potentially act as essential building blocks of life.

In this paper, the effect of multi-rotational speeds super-gravity field on the grain refinement and tensile properties of as-cast H13 steel were investigated systematically. The experimental results revealed that the as-cast grains of H13 steel can be significantly refined in multi-rotational speeds supergravity field. In conventional supergravity field, with the decrease of rotational radius, the secondary dendrite average spacing (SDAS) and the austenite grain average size (AGAS) increase, and the maximum values of SDAS and AGAS are 90 µm and 55 µm, respectively. while in multi-speeds supergravity fields, at the range of increasing rotational speeds, SDAS and AGAS decrease as the rotational radius decreases. In three-rotational speeds supergravity field, the maximum values of SDAS and AGAS are 80 µm and 50 µm. In five-rotational speeds supergravity field, the maximum values of SDAS and AGAS are reduced to 58 µm and 34 µm. Accordingly, both the tensile strength and the plasticity are enhanced with the increasing the number of rotational speeds in supergravity field, especially for the inner position of supergravity sample. The ultimate tensile strengths at outer, middle, and inner positions of H13 steel solidified in conventional supergravity field are 1445 MPa, 1378 MPa, and 1023 MPa, corresponding elongations of 2%, 1.5%, and 0.5%, while in the five-rotational speeds supergravity field, they are 1408 MPa, 1443 MPa, and 1453 MPa, corresponding elongations of 1.8%, 3.9%, and 2.2%. The mechanism for the grain refinement is that multi-speeds super-gravity can reduce the critical nucleation work of austenite, and the tangential force produced by changing the rotational speeds breaks dendrites at the solidification front, refining solidification structure.

Severe Acute Respiratory Syndrome CoronaVirus 2 (SARS-CoV-2) has claimed nearly 180,000 lives and continues to spread. There are currently no approved medications or vaccines for this new coronavirus. Studies have shown that the positive RNA genome of SARS-CoV-2 contains unique features, including a 12-base sequence inserted between the two subunits of viral receptor protein Spike. This inserted sequence facilitates the cleavage of Spike by the cellular proteases Furin and TMPRSS2, leading to the fusion of virus and host cell membranes. Current studies are mostly focused on the SARS-CoV-2 Spike protein and its interacting cellular proteins ACE2, Furin, and TMPRSS2. RNA structural studies are limited and little is known about the potential impact of the 12-base sequence insert on the secondary structure of SARS-CoV-2 genomic RNA and/or its transcripts. Here, by using local and global RNA secondary structure predictions, we show that the novel 12-base insert of SARS-CoV-2 genome likely induces a major RNA secondary structure change.

This paper presents a physical and mathematical model that has been developed in the framework of the approach used in the computational mechanics of materials. The model is designed to enable the study of the patterns of deformation and fracture of ceramic composites with a transformation-hardened matrix that are obtained by additive technologies at the mesoscopic and macroscopic levels under intense dynamic loading. The influence of the loading rate on the formation of the fracture and energy dissipation fronts for composite materials, based on the Al2O3 20%ZrO2 system, is shown. Nonlinear effects under intense dynamic loading in the considered composites are associated with the processes of self-organization of structural fragments at the mesoscopic level, as well as the occurrence of martensitic phase transformations in matrix volumes adjacent to the strengthening particles.

This paper develops a multi-task learning framework that attempts to incorporate the image structure knowledge to assist image inpainting, which is not well explored in previous works. The primary idea is to train a shared generator to simultaneously complete the corrupted image and corresponding structures --- edge and gradient, thus implicitly encouraging the generator to exploit relevant structure knowledge while inpainting. In the meantime, we also introduce a structure embedding scheme to explicitly embed the learned structure features into the inpainting process, thus to provide possible preconditions for image completion. Specifically, a novel pyramid structure loss is proposed to supervise structure learning and embedding. Moreover, an attention mechanism is developed to further exploit the recurrent structures and patterns in the image to refine the generated structures and contents. Through multi-task learning, structure embedding besides with attention, our framework takes advantage of the structure knowledge and outperforms several state-of-the-art methods on benchmark datasets quantitatively and qualitatively.

Poliovirus 2A protease (PV2Apro) plays a vital role in viral replication and down-regulation of host cell protein synthesis. In order to understand more concerning PV2Apro, the protein was over-expressed in bacteria following amplification using sense and antisense primers and cloning in pET15b. Several expression hosts were tested and BL21 (DE3) pLysS cells gave the best expression of PV2Apro with minimal unwanted protein expression following IPTG induction. The 2Apro protein was purified to homogeneity using column chromatography, its solubility determined and its molecular weight and composition determined by MALDI-TOF mass spectrometry. The protease was found in the insoluble fraction and the purified protein had a slightly lower molecular weight than predicted. Moreover, three dimensional structure was modelled using template 1z8r with 58% identity and validated using ramachandran plot. Results revealed that most of the residues lie in favoured and allowed regions. These findings could help in a better understanding of PV2Apro structure and inhibition thus, highlighting potential targets for antiviral drug development.

Concerning fan systems with an air pipe connecting air intake and a closed outlet, aerodynamic noise cannot be directly transmitted from the fan inlet and outlet to the outside. At this moment, the volute vibrational radiation noise induced casing surface vibration is the major noise component. The main factors affecting the fan vibrational noise are analyzed through theoretical derivation, then a vibrational noise optimization control method for the volute casing is proposed that considered the influence of vibro-acoustic coupling, taking the panel thickness of the volute (front-panel thickness [FT], side-panel thickness [ST], and back-panel thickness [BT]) as design variables, and the acoustical power of the volute surface and the total mass of the volute as the optimal target function. The optimization method is mainly divided into three main parts: the first was based on the simulation of unsteady flow of the fan to obtain the vibrational noise source; the second, using the design of experimental (DOE) method and the proposed numerical simulation of fluid-structure-acoustic coupling method to obtain the designing space, then the radical-based function (RBF) method is used to construct the approximate surrogate model instead of the simulation model previously mentioned, which was used to provide the basic mathematical model for the optimization of the next part; the third part, implementing the low vibrational noise optimization for the fan volute, applied the single-target (taking volute radiated acoustical power as the target function) and the multi-target (taking the volute radiated acoustical power and volute total mass as the target function) methods. In addition, the fan aerodynamic performance, volute casing surface fluctuations, and vibration response were validated by experiments, showing good agreement. It is of utmost importance that the dynamic pressure measurements and vibrational tests on the volute casing verify the accuracy of the numerical calculation. The optimization results showed that the vibrational noise optimization method proposed in this study can effectively reduce the vibration noise of the fan, obtaining a maximum value of noise reduction of 7.3 dB. The optimization identified in this paper provides a significant reference for the design of a low-vibrational-noise volute.

This work shows the preliminary description of the origin of a sedimentary - exhalative outcrop of Jurassic Lower Pliensbachian. The location of this deposit was achieved by applying an examination based in the identification of sedimentary transgressions of heterochronies ages and the identification of a Rift – type mega –structure. According with the methodology, it was carried out a study of the discordant relationships between two types of sediments: continental and marine. According the characterization, it was noted the existence of light rare earths, in values that show positive anomalies in comparison with the distribution of elements in upper continental crust according to the Clarke [1], reflecting so a felsic affinity of the mineral deposit. Also, positive anomalies of platinum and Pd, were determined with marginal contents of Au and Ag; and finally the base metals Zn, Pb and Cu were detected in low contents, which could be due to the presence of altered shale. According to the sedimentary lithology found, which was of siliciclastic type; to the exhalative roots observed during the fieldwork; the presence of quartz minerals such as biotite and muscovite; the presence of minerals of hydrothermal remobilization like chalcopyrite with some base metals, altered shale, as well as sulfur deficiency; this mineral reservoir could be defined as a SEDEX – type.

Two novel inorganic–organic hybrid supramolecular assemblies, namely, (4-HNA)(18-crown-6)(HSO₄) (1) and (4-HNA)₂(18-crown-6)₂(PF₆)₂(CH₃OH) (2) (4-HNA = 4-nitroanilinium), were synthesized and characterized by infrared spectroscopy, single X-ray diffraction, differential scanning calorimetry (DSC), and temperature-dependent dielectric measurements. The two compounds underwent reversible phase transitions at about 255 K and 265 K, respectively. These phase transitions were revealed and confirmed by the thermal anomalies in DSC measurements and abrupt dielectric anomalies during heating. The phase transition may have originated from the [(4-HNA)(18-crown-6)]⁺ supramolecular cation. The inorganic anions tuned the crystal packings and thus influenced the phase-transition points and types. The variable-temperature X-ray diffraction data for crystal 1 revealed the occurrence of a phase transition in the high-temperature phase with the space group of P2₁/c and in the low-temperature phase with the space group of P2₁/n. Crystal 2 exhibited the same space group P2₁/c at different temperatures. The results indicated that crystals 1 and 2 both underwent an iso-structural phase transition.

In the current paper, a residual generation filter with finite memory structure is proposed for sensor fault detection. The proposed finite memory residual generation filter provides the residual by real-time filtering of fault vector using only the most recent finite observations and inputs on the window. It is shown that the residual given by the proposed residual generation filter provides the exact fault for noise-free systems. The proposed residual generation filter is specified to the digital filter structure for the amenability to hardware implementation. Finally, to illustrate the capability of the proposed residual generation filter, numerical examples are performed for the discretized DC motor system having the multiple sensor faults.

A series of water diversion projects to address the uneven distribution of water resources in China involve the construction of a large number of hydraulic tunnels. As the lining structure that maintains the stability and durability of the tunnels, it is prone to durability damage during the operation process, which in turn affects the water transmission safety and water supply capacity. Therefore, it is important to evaluate the durability of hydraulic tunnel lining structure. Considering the randomness and fuzziness of the factors affecting the durability of hydraulic tunnel lining structure, this paper proposes a comprehensive evaluation model based on the coupling of set-pair analysis and extension. The G1 method and the simple correlation function method are used to determine the subjective and objective weights of the evaluation indexes respectively, and the combination weight is assigned based on the principle of minimum entropy; the set-pair analysis principle is used to establish the linkage affiliation function, calculate the comprehensive linkage affiliation of the object to be evaluated, and the maximum affiliation principle is used to judge the durability level of the hydraulic tunnel lining structure. Finally, taking a section of hydraulic tunnel as an example, the model proposed in this paper is used to calculate its durability grade as Class III, with the set-pair potential SHI(H) = 7.5856, which is consistent with the actual engineering practice, and a comparative study is done in combination with the AHP-Extenics method. It is verified that the evaluation model can scientifically and reasonably evaluate the durability of hydraulic tunnel lining structure, providing a basis for subsequent maintenance and reinforcement.

A common task in the immunodetection of structurally close compounds is to analyze the selectivity of immune recognition: it is required to understand the regularities of immune recognition and to elucidate the basic structural elements which provide it. Triazines are compounds of particular interest for such a research due to their high variability and the necessity of their monitoring to provide safety of agricultural products and foodstuffs. We evaluated the binding of 20 triazines with polyclonal (pAb) and monoclonal (mAb) antibodies obtained using atrazine as the immunogenic hapten. A total of >3000 descriptors was used in QSAR analysis of binding activities (pIC50). Comparison of the two enzyme immunoassay systems showed that the system with pAb is much easier to describe using 2D QSAR methodology, while the system with mAb can be described using the 3D QSAR COMFA. Thus, for the 3D QSAR model of the polyclonal antibodies, the main statistical parameter q² (‘leave-many-out’) is equal 0.498, and for monoclonal antibodies q² is equal 0.566. Obviously, in the case of pAb, we deal with several targets, while in the case of mAb the target is one, and therefore it is easier to describe it using specific fields of molecular interactions distributed in space.

In this work, three different types of sandwich structures were manufactured using Formica sheet (a paper-based sheet) as skin and perlite/sodium silicate foam as core with/without the paper honeycomb. The sandwich structures were fabricated by attaching Formica sheets on both sides of the honeycomb, perlite/sodium silicate foam, and perlite/sodium silicate foam-filled honeycomb core panels. The flexural characteristics were studied by a three-point bending test and the thermal conductivity was measured using Lee’s thermal conductivity apparatus. The results demonstrated a significant improvement in flexural properties, including core shear stress, facing stress, bending stress, and energy absorption, when incorporating the paper honeycomb reinforcement. The thermal conductivity and flexural properties were found to be well-compatible with the existing building materials for similar applications in the literature. The failure investigation revealed that the sandwiches with paper honeycomb only prematurely failed due to core buckling, whereas the foam-filled honeycomb core-based sandwiches were able to sustain higher loads, exhibiting material failures such as core shear failure, skin rapture, and delamination. It is found that the foam-filled paper honeycomb sandwich structures can withstand higher bending loads compared to foam core-based and paper honeycomb-based sandwich structures. These developed sandwiches offer potential as green materials due to the characteristics of their constituent materials and can find valuable applications in the building thermal insulation.

Every protein consists of a linear sequence over an alphabet of $20$ letters/amino acids. The sequence unfolds in the $3$-dimensional space through secondary (local foldings), tertiary (bonds) and quaternary (disjoint multiple) structures. The mere existence of the genetic code for the $20$ letters of the linear chain could be predicted with the (informationally complete) irreducible characters of the finite group $G_n:=\mathbb{Z}_n \rtimes 2O$ (with $n=5$ or $7$ and $2O$ the binary octahedral group) in our previous two papers. It turns out that some quaternary structures of protein complexes display $n$-fold symmetries. We propose an approach of secondary structures based on free group theory. Our results are compared to other approaches of predicting secondary structures of proteins in terms of $\alpha$ helices, $\beta$ sheets and coils, or more refined techniques. It is shown that the secondary structure of proteins shows similarities to the structure of some hyperbolic $3$-manifolds. The hyperbolic $3$-manifold of smallest volume --Gieseking manifold--, some other $3$ manifolds and the oriented hypercartographic group are singled out as tentative models of such secondary structures. For the quaternary structure, there are links to the Kummer surface.

The capacity and the mechanism of the adsorption of aqueous barium (Ba), cobalt (Co), strontium (Sr) and zinc (Zn) by Ecuadorian (NatAllo) and synthetic (SynAllo-1 and SynAllo-2) allophanes were studied as a function of contact time, pH and metal ion concentration using kinetic and equilibrium experiments. The mineralogy, nano-structure and chemical composition of the allophanes were characterized by X-ray diffraction, Fourier transform infrared spectroscopy, transmission electron microscopy and specific surface area analyses. The evolution of adsorption fitted to a pseudo-first-order reaction kinetics, where equilibrium between aqueous metal ions and allophane was reached within < 10 min. The metal ion removal efficiencies varied from 0.7 to 99.7 % at pH 4.0 to 8.5. At equilibrium, the adsorption behavior is better described by the Langmuir model than by the Dubinin-Radushkevich model, yielding sorption capacities of 10.6, 17.2 and 38.6 mg/g for Ba^(2+), 12.4, 19.3 and 29.0 mg/g for HCoO_2^-, 7.2, 15.9 and 34.4 mg/g for Sr^(2+) and 20.9, 26.9 and 36.9 mg/g for Zn^(2+), respectively, by NatAllo, SynAllo-2 and SynAllo-1. The uptake mechanism is based on a physical adsorption process. Allophane holds great potential to remove aqueous metal ions and could be used instead of zeolites, montmorillonite, carbonates and phosphates for wastewater treatment.

Modelling errors, robust stabilization/tracking problems under parameter and model uncertainties complicate the control of the flexible underactuated systems. Chattering-free sliding-mode based input-output control law realizes robustness against the structured and unstructured uncertainties in the system dynamics and avoids excitation of unmodeled dynamics. The main purpose is to propose a robust adaptive solution for stabilizing and tracking direct-drive (DD) flexible robot arms under parameter and model uncertainties, as well as external disturbances. A lightweight robot arm subject to external and internal dynamic effects was taken into consideration. The challenges are compensating actuator dynamics with the inverter switching effects and torque ripples, stabilizing the zero dynamics under parameter/model uncertainties and disturbances while precisely track the predefined reference position. The precise control of this kind of system demands an accurate system model and knowledge of all sources that excite unmodeled dynamics. For this purpose, equations of motion for a flexible robot arm were derived and formulated for the large motion via Lagrange’s method. The goals were determined to achieve high-speed, precise position control, and satisfied accuracy by compensating the unwanted torque ripple and friction that degrades performance through an adaptive robust control approach. The actuator dynamics and their effect on the torque output were investigated due to the transmitted torque to the load side. The high-performance goals, precision&robustness issues, and stability concerns were satisfied by using robust-adaptive input-output linearization-based control law combining chattering-free sliding mode control (SMC) while avoiding the excitation of unmodeled dynamics.

Pairs of pyrrolysyl-tRNA synthetase (PylRS) and tRNAPyl from Methanosarcina mazei and Methanosarcina barkeri are widely used for site-specific incorporations of non-canonical amino acids into proteins (genetic code expansion). Previously, we achieved full productivity of cell-free protein synthesis for bulky non-canonical amino acids, including Ne-((((E)-cyclooct-2-en-1-yl)oxy)carbonyl)-L-lysine (TCO*Lys), by using Methanomethylophilus alvus PylRS with structure-based mutations in and around the amino acid binding pocket (first-layer and second-layer mutations, respectively). Recently, the PylRS•tRNAPyl pair from a methanogenic archaeon ISO4-G1 was used for genetic code expansion. In the present study, we determined the crystal structure of the methanogenic archaeon ISO4-G1 PylRS (ISO4-G1 PylRS) and compared it with those of structure-known PylRSs. Based on the ISO4-G1 PylRS structure, we attempted the site-specific incorporation of Ne-(p-ethynylbenzyloxycarbonyl)-L-lysine (pEtZLys) into proteins, but it was much less efficient than that of TCO*Lys with M. alvus PylRS mutants. Thus, the first-layer mutations (Y125A and M128L) of ISO4-G1 PylRS, with no additional second-layer mutations, increased the protein productivity with pEtZLys up to 578% of that with TCO*Lys, at high enzyme concentrations in the cell-free protein synthesis.

The availability of sufficient amounts of form I of benzocaine has led to the investigation of its phase relationships with the other two existing forms II and III using adiabatic calorimetry, powder X-ray diffraction, and high-pressure differential thermal analysis. The latter two forms were known to have an enantiotropic phase relationship with form III stable at low-temperature and high-pressure, while form II is stable at room temperature. Using adiabatic calorimetry data, it can be concluded, that form I is the stable low-temperature, high-pressure form, which also happens to be stable at room temperature; however, form II, due to its persistence at room temperature, is still the most convenient polymorph to use in formulations. Form III presents a case of overall monotropy and does not possess any stability domain in the pressure-temperature phase diagram. Heat capacity data for benzocaine have been obtained by adiabatic calorimetry from 11 K up to 369 K above its melting point, which can be used to compare to results from in-silico crystal structure prediction.

The radiosensitivity of biological systems is strongly affected by the system oxygenation. On the nanoscopic scale and molecular level, this effect is considered to be strongly related to the indirect damage of radiation. Even though particle track radiolysis has been the object of several studies, still little is known about the nanoscopic impact of target oxygenation on the radical yields. We present here an extension of the chemical module of the Monte Carlo particle track structure code TRAX, taking into account the presence of dissolved molecular oxygen in the target material. The impact of the target oxygenation level on the chemical track evolution and the yields of all the relevant chemical species is studied in water under different irradiation conditions: different linear energy transfer (LET) values, different oxygenation levels, and different particle types. Especially for low LET radiation, a large production of two highly toxic species (HO₂^• and O₂^•− ), which are not produced in anoxic conditions, is predicted and quantified in oxygenated solutions. The remarkable correlation between the HO₂^• and O₂^•− production yield and the oxygen enhancement ratio observed in biological systems suggests a direct or indirect involvement of HO₂^• and O₂^•− in the oxygen sensitization effect. The results are in agreement with available experimental data and previous computational approaches. An analysis of the oxygen depletion rate in different radiation conditions is also reported.

The one-to-one structural correspondence between any conjugated hydrocarbon CnHm and the borane BnHm+n is extended here, with the B3LYP/cc-pVDZ model, to pure conjugated carbon systems with the example of buckminsterfullerene C60 with the corresponding icosahedral isoelectronic system closo-borane B60H60, and the fluorine substituted systems B60F30H30 and B60F60 , all with icosahedral Ih symmetry. All systems correspond to energy minima in the potential energy hypersurface, except for B60(F30)in(H30)out . Selected electronic structure methods are used to characterize all systems: molecular electrostatic potentials (MEP), atomic charges, bond orders, and topological properties of the electron density within quantum theory of atoms-in-molecules (QTAIM) and electron-localization function (ELF) theory. In the particular case of B60H60 we use the recently developed Hückeloid model to characterize this system. The stability of the energy minimum icosahedral structure B60F60 could have an origin in F···F attractive interactions of the inner fluorine atoms of the cage.

Corona viruses hijack human enzymes to assembly sugar coat on Spike glycoproteins. The mechanism that human antibodies may uncover the antigenic viral peptide epitopes hidden by sugar coat are unknown. In this study, we analyzed recombinant SARS-CoV-2 Spike protein secreted from BTI-Tn-5B1-4 cells, by trypsin and chymotrypsin digestion followed by mass spectrometry analysis. We acquired MS/MS spectrums for glycopeptides of all 22 predicted N-glycosylated sites. We further analyzed the surface accessibility of Spike proteins according to Cryo-EM and homolog-modeled structures, and available antibodies that bind to SARS-CoV-1. The results showed that all 22 N-glycosylated sites of SARS-CoV-2 are modified by high-mannose type of N-glycans. MS/MS fragmentation clearly established the glycopeptide identities. Electron densities of glycans cover most of the Spike receptor binding domain of SARS-CoV-2, except YQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQ, similar to a region FSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQ in SARS-CoV-1. Other surface-exposed domains included those located on Central Helix, between amino acids 967 and 1016 of SARS-CoV-1, and 985 to 1034 of SARS-CoV-2 Spike protein. As the majority of antibody paratopes bind to peptide portion with or without sugar modification, we propose a snake-catcher model that a minimal length of peptide is first clamped by a paratope, and the binding is either strengthened by sugars close to peptide, or not interfered by sugar modification.

The importance of antibodies in health care and the biotechnology research and development demands not only knowledge of their experimental structures at high resolution, but also practical implementation of this knowledge for both effective and efficient design and production of antibody for its use in both medical and research applications. While the experimental wet-lab approach is usually costly, laborious and time-consuming, computational (dry-lab) approaches, in spite of their intrinsic limitations in comparison with its experimental (wet-lab) counterpart, provide a cheaper and faster alternative option. For the first time, this article reports a comprehensive set of structural electrostatic features extracted from experimentally determined antigen-antibody-related structures, including especially those structural electrostatic features at the interfaces of all experimentally determined antigen-antibody complex structures as of February 29, 2020, to facilitate effective and efficient machine learning-based computational antibody design using currently available experimental structures inside Protein Data Bank.

The flux growth of InVO4 bulk single crystals has been explored for the first time. The reported eutectic composition at a ratio of V2O5:InVO4 = 1:1 could not be used as a self-flux, since no sign of melting was observed up to 1100 °C. Crystals of InVO4 of typical size 0.5×1×7 mm3 were obtained using copper pyrovanadate (Cu2V2O7) as a flux, using Pt crucibles. XRD confirmed the orthorhombic Cmcm structure. Rests of flux material were observed on the sample surface, with occasional traces of Pt indicating some level of reaction with the crucible. X-ray absorption spectroscopy showed that oxidation states of indium and vanadium ions are +3 and +5, respectively. The size and high quality of the obtained InVO4 crystals makes them excellent candidates for the further study of their physical properties.

G protein-coupled receptors (GPCRs) are amongst the most pharmaceutically relevant and well-studied protein targets, yet unanswered questions in the field leave significant gaps in our understanding of their nuanced structure and function. 3D pharmacophore models are powerful computational tools in silico drug discovery, presenting myriad opportunities for the integration of GPCR structural biology and cheminformatics. This review highlights success stories in the application of 3D pharmacophore modeling to de novo drug design, discovery of biased and allosteric ligands, scaffold hopping, QSAR analysis, hit-to-lead optimization, GPCR de-orphanization, mechanistic understanding of GPCR pharmacology and elucidation of ligand-receptor interactions. Furthermore, advances in the incorporation of dynamics and machine learning will be highlighted. The review will analyze challenges in the field of GPCR drug discovery, detailing how 3D pharmacophore modeling can be used to address them. Finally, we will present opportunities afforded by 3D pharmacophore modeling in the advancement of our understanding and targeting of GPCRs.

Ecosystem surveillance monitoring is critical to managing natural resources and especially so under changing environments. Despite this importance, the design and implementation of monitoring programs across large temporal and spatial scales has been hampered by the lack of appropriately standardised methods and data streams. To address this gap, we outline a surveillance monitoring method based on permanent plots and voucher samples suited to rangeland environments around the world that is repeatable, cost-effective, appropriate for large-scale comparisons and adaptable to other global biomes. The method provides comprehensive data on vegetation composition and structure along with soil attributes relevant to plant growth, delivered as a combination of modules that can be targeted for different purposes or available resources. Plots are located in a stratified design across vegetation units, landforms and climates to enhance continental and global comparisons. Changes are investigated through revisits. Vegetation is measured to inform on composition, cover and structure. Samples of vegetation and soils are collected and tracked by barcode labels and stored long-term for subsequent analysis. Technology is used to enhance the accuracy of field methods, including differential GPS r plot locations, instrument based Leaf Area Index (LAI) measures, and three dimensional photo-panoramas for advanced analysis. A key feature of the method is the use of electronic field data collection to enhance data delivery into a publicly-accessible database.Our method is pragmatic, whilst still providing consistent data, information and samples on key vegetation and soil attributes. The method is operational and has been applied at more than 704 field locations across the Australian rangelands as part of the Ecosystem Surveillance program of the Terrestrial Ecosystem Research Network (TERN). The methodology enables continental analyses, and has been tested in communities broadly representative of rangelands globally, with components being applicable to other biomes. Here we also recommend the consultative process and guiding principles that drove the development of this method as an approach for development of the method into other biomes. The consistent, standardised and objective method enables continental, and potentially global analyses than were not previously possible with disparate programs and datasets.

The Ames/quantitative structure-activity relationship (QSAR) International Challenge Projects held during 2014–2017 and 2020–2022, evaluated the performance of various predictive models. Despite the significant insights gained, the rules allowing participants to select prediction targets introduced ambiguity in model performance evaluation. This reanalysis identified the highest-performing prediction model, assuming a 100% coverage rate (COV) for all prediction target compounds and an estimated performance variation due to changes in COV. All models from both projects were evaluated using balance accuracy (BA), Matthews correlation coefficient (MCC), F1 Score (F1), and the first principal component (PC1). After normalizing the COV, a correlation analysis with these indicators was conducted, and the evaluation index for all prediction models in terms of the COV was estimated. In total, 109 models, the highest estimated BA (76.9) at 100% COV was MMI-VOTE1, reported by Meiji Pharmaceutical University (MPU). The best models for MCC, F1, and PC1 were all MMI-STK1, also reported by MPU. All models reported by MPU ranked in the top four. MMI-STK1 was estimated to have F1 scores of 59.2, 61.5, and 63.1 at COV levels of 90%, 60%, and 30%, respectively. These findings highlight the current state and potential of the Ames prediction technology.

During the last decades the quantitative description of electrical and magnetotransport properties of solid-state materials has been a remarkable challenge in materials science. Recently, the discovery of a novel class of materials, the topological semimetals, has led to a growing interest for the full understanding of their magnetotransport properties. In this review, the strong interplay among topology, band structure and carrier mobility in recently discovered high carriers mobility topological semimetals is discussed and their effect on their magnetotransport properties is outlined. The huge magnetoresistance effect, especially in the Hall transverse configuration, and a new version of a three-dimensional quantum Hall effect observed in high-mobility Weyl and Dirac semimetals are reviewed. The design of novel quantum sensors based on solid-state semimetals is also encouraged.

This article examines experiments with elastic material, specifically the deformation of an elastic tube under hydrostatic pressure with a constant flow of fluid inside. This flow induces a pulsatile movement within the elastic tube. Preliminary results are compared with a theoretical model that combines longitudinal and transverse waves. During the experiment, images at various stages of deformation were captured and analyzed. The objective is to better understand the behavior of elastic materials under these conditions and validate the proposed theoretical model through detailed experimental observations, providing a deeper insight into the dynamics of deformation in deformable materials.

Point defects induced by doping rare earth elements RE (Nd, Er) into the magnesium oxide host were investigated by classical atomistic simulations utilising the General Utility Lattice Program (GULP). Formation and association energies were calculated for the potential defect structures. Both isolated defects and defect complexes were considered. The most energetically favourable structures of defect complexes were found for rare earth doped and Li co-doped systems. The correlation between the association energy and the structure of the defect complex was investigated. The influences of Li were revealed with respect to energy and structure. The simulation results contribute to the understanding of the point defects of doped MgO and how Li influences the doping of rare earth elements in the MgO host.

Repurposing previously approved drugs may fast track the route to clinic for potential senotherapeutics and improves the inefficiency of the clinical drug development pipeline. We carried out a repurposing screen of 240 clinically approved molecules in human primary dermal fibroblasts for effects on CDKN2A expression. Molecules demonstrating effects on CDKN2A expression underwent secondary screening for senescence-associated beta galactosidase (SAB) activity, based on effect size, direction and/or molecule identity. Selected molecules then underwent a more detailed assessment of senescence phenotypes including proliferation, apoptosis, DNA damage, senescence-associated secretory phenotype (SASP) expression and regulators of alternative splicing. A selection of the molecules demonstrating effects on senescence were then used in a new bioinformatic structure-function screen to identify common structural motifs. 90 molecules displayed altered CDKN2A expression at one or other dose, of which 15 also displayed effects on SAB positivity in primary human dermal fibroblasts. Of these, three were associated with increased SAB activity, and 11 with reduced activity. The female synthetic sex hormones; diethylstilboestrol, ethynyl estradiol and levonorgestrel; were all associated with a reduction in aspects of the senescence phenotype in male cells, with no effects visible in female cells. Finally, we identified that the 30 compounds that decreased CDKN2A activity the most had a common substructure linked to this function. Our results suggest that several drugs licenced for other indications may warrant exploration as future senotherapies, but that different donors and potentially different sexes may respond differently to senotherapeutic compounds. This underlines the importance of consideration of donor-related characteristics when designing drug screening platforms.

Mapping building roof plane structures is an active research direction in urban-related studies, as understanding roof structure provides essential information for generating highly detailed 3D building models. Traditional deep learning models have been the main focus of most recent research endeavours aiming to extract pixel-based building roof plane areas from remote sensing imagery. However, significant challenges arise, such as delineating complex roof boundaries and invisible boundaries. Additionally, challenges during the post-processing phase, where pix-el-based building roof plane maps are vectorized, often result in polygons with irregular shapes. In order to address this issue, this study explores a state-of-the-art method for planar graph reconstruction applied to building roof plane extraction. We propose a framework for reconstructing regularized building roof plane structures using aerial imagery and cadastral information. Our framework employs a holistic edge classification architecture based on an attention-based neural network to detect corners and edges between them from aerial imagery. Our experiments focused on three distinct study areas characterized by different roof structure topologies: Stadsveld – 't Zwering neighbourhood and Oude Markt area, located in Enschede, The Netherlands, and the Lozenets district in Sofia, Bulgaria. The outcomes of our experiments revealed that a model trained with a combined dataset of two different study areas demonstrated superior performance, capable of delineating edges obscured by shadows or canopy. Our experiment in the Oude Markt area resulted in building roof plane delineation with an F-score value of 0.43 when the model trained on the combined dataset was used. In comparison, the model trained only on the Stadsveld – 't Zwering dataset achieved an F-score value of 0.37, and the model trained only on the Lozenets dataset achieved an F-score value of 0.32. The results from the developed approach are promising and can be used for 3D city modelling in different urban settings.

In recent decades, porous scaffolds for bone tissue engineering (BTE) have gained significant attention. Considerable research efforts have been dedicated to investigating the impact of scaffold pore size on a diverse array of biological processes, including cell-scaffold interactions, substance transportation, and vascularization. However, the multi-scale hierarchical porosity, a key structural characteristic of natural bone, has rarely been replicated in BTE scaffolds due to the challenges of controlling the scaffold structure across multiple length scales. With the advancement of manufacturing technology, there has been increasing research on biomimetic multi-scale hierarchical materials, which are also gaining favor in the field of BTE. Therefore, there is an urgent need to review multi-scale hierarchical porous BTE scaffolds. This paper aims to review the role and fabrication methods of multi-scale porous BTE scaffolds at different length scales, the design and manufacturing of new BTE scaffolds for bone regeneration.

Although other methods exist to store and manage data in modern information technology, the standard solution are file systems. Therefore keeping well-organized file structures and file system layouts can be key to a sustainable research data management infrastructure. However, file structures alone are lacking several important capabilities for FAIR data management: The two most striking are insufficient visualization of data and inadequate possibilities for searching and getting an overview. Research data management systems (RDMS) can fill this gap, but many do not support the simultaneous use of the file system and the RDMS. This simultaneous use can have many benefits, but keeping data in the RDMS in synchrony with the file structure is challenging. Here, we present concepts that allow to keep file structures and semantic data models (in RDMS) synchronous. Furthermore, we propose a specification in yaml-format that allows for a structured and extensible declaration and implementation of a mapping between the file system and data models used in semantic research data management. Implementing these concepts will facilitate the re-use of specifications for multiple use cases. Furthermore, the specification can serve as a machine-readable and, at the same time, human-readable documentation of specific file system structures. We demonstrate our work using the Open Source RDMS CaosDB.

In this research, the application of the Physics-Informed Neural Network (PINN) model is explored to solve transport equation-based Partial Differential Equations (PDEs). The primary objective is to analyze the impact of different activation functions incorporated within the PINN model on its predictive performance, specifically assessing the Mean Squared Error (MSE) and Mean Absolute Error (MAE). The dataset used in the study consists of a varied set of input parameters related to strut diameter, unit cell size, and the corresponding yield stress values. Through this investigation, the aim is to understand the effectiveness of the PINN model and the significance of choosing appropriate activation functions for solving complex PDEs in real-world applications. The outcomes suggest that the choice of activation function may have minimal influence on the model's predictive accuracy for this particular problem. The PINN model showcases exceptional generalization capabilities, indicating its capacity to avoid overfitting with the provided dataset. The research underscores the importance of striking a balance between performance and computational efficiency while selecting an activation function for specific real-world applications. These valuable findings contribute to advancing the understanding and potential adoption of PINN as an effective tool for solving challenging PDEs in diverse scientific and engineering domains.

In recent years discrete element method (DEM) has gradually been applied to the traditional fluidization simulation of fine particles in micro fluidized bed (MFB). The application of DEM in simulating fast fluidization of fine particles in MFB has not yet received attention. This article presents a drag model that relies on the surrounding environment of particles, namely particle circumstance-dependent drag modle or PCDD model. Fast fluidization in MFB of fine particles is simulated using DEM based on the PCDD model. It is found that the gas-solid two-phase flow in MFB meets the common law of fast fluidization in circulating fluidized bed (CFB) to a certain extent, and also presents a special law that is significantly different from that in CFB. Simulations indicate that the local structure in MFB exhibits particle aggregation which is a natural property of fast fluidized, forming a structure where continuous dilute phase and dispersed concentrated phase coexist. The formation and fragmentation of particle clusters in different local regions of the bed have time synchronization. There exists strong effect of solid back-mixing in MFB, leading to relatively low outlet solid flux. The gas back-mixing effect is, however, not so distinct. The axial porosity shows a monotonically increasing distribution with the bed height, but does not strictly follow the single exponential distribution. The solid volume fraction at the bottom of the bed is significantly lower than the correlated value in CFB. The axial heterogeneous distribution of the cross-sectional average porosity in the lower half of the bed is also weakened. The radial porosity shows a distribution pattern of higher in the central region and lower in the sidewall region. Compared with the correlation results in CFB, the porosity near the central region in MFB is relatively low, while the porosity near the sidewall region is relatively high. The geometric size of the container, especially the radial size, is much smaller than that of a CFB. The relative area of contact between the MFB wall and particles is larger, and the wall friction factor becomes more significant. This may be the main reason for the time synchronization of particle agglomeration, severe particle back-mixing, low outlet solid flux, monotonically increasing axial porosity and weak core-annular structure of radial porosity.

This study investigates the influence of the porous structure, on the density and the mechanical behaviour of new foam concretes incorporating hemp shives. A total of eight batches of foam concretes were manufactured and tested, made with a protein-based foam agent, containing cement, ground granulated blast furnace slag and Metakaolin as binder and hemp shives as natural aggregate. The effect of several parameters is studied, elaboration method (direct and preformed), amount of pozzolanic additions (0% and 30%) and incorporation of hemp shives (5 and 15 vol%) on the resulting physical properties, microstructure, porous structure and mechanical behaviour of the concretes. Hemp shives incorporation results in increased concrete porosity and air bubble radius, decreased uniformity and mechanical strength, and lower cohesion with the cement matrix compared to standard concretes.

Tuberculosis (TB) is a leading infectious disease with serious antibiotic resistance. The benzothiazinone (BTZ) scaffold PBTZ169, an inhibitor of the decaprenylphosphoryl-β-D-ribose 2'-oxidase (DprE1) in Mycobacterium tuberculosis (Mtb), showed anti-TB potential in animal model and piloted clinical tests. Although highly potent, the BTZ type DprE1 inhibitors in general shows extremely low aqueous solubility, which adversely affect the drug like property. To improve the compounds physiochemical properties, we generated a series of BTZ analogues. Several optimized compounds had MIC values against Mtb in single digit nanomolar. The representative compound 37 displayed improved solubility and bioavailability compared to the lead compound. Additionally, compound 37 shows Mtb-killing ability in an acute infection mouse model.

Synthesis of ZSM-5 zeolite from OSDA-free systems has been a very interesting alternative method because it can avoid the usage of organic templates and consequent calcination step. However, in opened reports, organic substance such as alcohol is more or less involved. In the present work, a calcined commercial ZSM-5 zeolite was used as a seed, sodium aluminate as an aluminum source, silica sol as a silicon source, which ensures that there is no any organics (template) in the synthesis system, and polycrystalline ZSM-5 aggregates consisting of rod-like nanocrystals are successfully prepared in a completely OSDA-free system. The effects of seed (chemical component, dosage) and crystallization conditions on the synthesis of ZSM-5 were systematically investigated. The results show that highly crystallinity ZSM-5 aggregate consisting of primary nano-sized crystals with a size of less than 100 nm can be yielded from a gel precursor with 5.6 wt.% seed after hydrothermal treatment for 48 h. The results also shows that the chemical composition of the seeds had little effect on the topological structure and pore structure of the synthesized samples, but the seed with a low Si/Al ratio is more conducive to the rapid crystallization of zeolite and to the improvement of the acid, especially the strong acid centers of the catalyst.

Silicon has a theoretical specific capacity of 4200 mAh g−1, which is considered to have significant potential for anode materials in lithium-ion batteries (LIBs). However, the volume change that occurs in silicon during charging and discharging affects the development of commercial applications. In this work, a yolk-shell structured Si@void@C anode material has been developed to address this problem. The silicon nanoparticle yolk material is obtained by recycling kerf-loss (KL) Si waste from the photovoltaic industry, the carbon shell is prepared via a hydrothermal process with glucose, and the sacrificial interlayer is Al2O3. The synthesized material is used to fabricate anodes that show a high reversible capacity of 836 mAh g−1 at the current density of 0.1 A g−1 after 100 cycles, with a Coulomb efficiency of 71.4%. This work demonstrates a relatively low-cost approach to turn KL Si waste into value-added materials for LIBs.

Single-Molecule Magnets (SMMs) have attracted much interest because of their spin properties and potential technological applications. Besides, a great effort has been devoted to their functionalization, which is made with functional groups convenient to connect suitable SMMs to junction devices or to perform their grafting on surfaces of different substrates. We have synthesized and characterized two lipoic acid-functionalized and oxime-based MnIII compounds, of formula [Mn6(μ3-O)2(H2N-sao)6(lip)2(MeOH)6][Mn6(μ3-O)2(H2N-sao)6(cnph)2(MeOH)6]}·10MeOH (1) and [Mn6(μ3-O)2(H2N-sao)6(lip)2(EtOH)6]·EtOH·2H2O (2) [H2N-saoH2 = salicylamidoxime, lip = lipoate anion, cnph = 2-cyanophenolate anion]. 1 crystallizes in the triclinic system with space group Pī and 2 crystallizes in the monoclinic system with space group C2/c. In their crystal packing, adjacent Mn6 complexes are connected through non-coordinating solvent molecules, which are H-bonded to N atoms of –NH2 groups of salicylamidoxime ligand. In addition, Hirshfeld surfaces of 1 and 2 were calculated to study the variety of intermolecular interactions and different level of importance that take place in their crystal lattice, this type of computed study being the first time performed on Mn6 molecules. The study of the magnetic properties of 1 and 2 through dc magnetic susceptibility measurements reveals the coexistence of ferro- and antiferromagnetic exchange couplings between the Mn(III) metal ions in both compounds, the latter being the predominant magnetic interaction. A ground state spin value of S = 4 was obtained through isotropic simulations of the experimental magnetic susceptibility data for both 1 and 2. Ac magnetic susceptibility measurements show the occurrence of slow relaxation of the magnetization in 1 and 2, which indicate that SMM behavior take place in both compounds.

A flexible structure is applied to improve the lubrication performance of a misaligned journal bearing. The journal bearing is representative sliding bearing and there are damages due to metal-to-metal contact by misalignment. Since misalignment is an unavoidable phenomenon, a journal bearing with a flexible structure was proposed as a way to improve it. The lubrication characteristics of the bearing are evaluated numerically under steady-state condition. EHL (elastohydrodynamic lubrication) analysis considering elastic deformation was performed. The lubrication performance is compared in accordance with variation of the geometry of the flexible structure and evaluated based on the minimum film thickness. Moreover, the results of the journal bearing with flexible structure are compared with those of the journal bearing without the flexible structure. The flexible structure is then applied in the form of a groove to the area supporting high load on the journal bearing; it is elastically deformed by the generated oil-film pressure, which helps to obscure a larger oil film. Through numerical analysis, it is found that the journal bearing with flexible structure can improve the lubrication performance in the misaligned condition.

The evolution in the post shock nonequilibrium relaxation in a hypersonic plasma flow was investigated during a shock’s reflection off a thermal discontinuity. Within a transitional period, the relaxation zone parameters past both, the reflected and transmitted waves, evolve differently compared to that in the incident wave. In a numerical example for the non-dissociating N₂ gas heated to 5000 K/10,000 K across the interface and M = 3.5, the relaxation time for the transmitted wave is up to 50% shorter and the relaxation depth for both waves is significantly reduced, thus resulting in a weakened wave structure. The results of extension into larger values of heating strength and the shock Mach numbers are discussed. The findings can be useful in the areas of research involving strong shocks interacting with optical discharges or other heated media on the scale where the shock structure becomes important.

Structure–function relationships in proteins have been one of the crucial scientific topics. Heme proteins have diverse and pivotal biological functions. Therefore, clarifying their structure–function correlation is significant to understand their functional mechanism and is informative for various fields of science. In this study, we constructed convolutional neural network models for predicting protein functions from the tertiary structures of heme-binding sites (active sites) of heme proteins to examine the structure–function correlation. As a result, we succeeded in the classification of oxygen-binding protein (OB), oxidoreductase (OR), proteins with both functions (OB–OR), and electron transport protein (ET) with high accuracy. Although the misclassification rate for OR and ET was high, the rates between OB and ET and between OB and OR were almost zero, indicating that the prediction model works well between protein groups with very different functions. However, predicting the function of proteins modified with amino acid mutation(s) remains a challenge. Our findings indicate a structure–function correlation in the active site of heme proteins. This study is expected to be applied to the prediction of more detailed protein functions such as catalytic reactions.

In the speed control system of Interior Permanent Magnet Synchronous Motor (IPMSM) without a speed sensor, the speed under the traditional PI control suffers from poor tracking performance and step response overshoot. This paper proposes a Compound Variable Structure PI (CVSPI) controller to improve the system control performance. It can choose whether to include an integral term according to the size of the system deviation to speed up the response. It also introduces a Model Reference Adaptive System (MRAS) speed observer in the controller to estimate the speed and adaptively adjust the size of the anti-integration saturation gain to improve the dynamic response following performance and immunity of the system. A feed-forward link is added for a given input differential to achieve an accurate answer to time-varying inputs. As the linear compensation matrix of the conventional MRAS is a unit matrix, the speed can only be accurately observed in a specific speed range. In this paper, a new linear compensation matrix is designed, and a new speed adaptive law is derived, allowing the improved MRAS to measure speed over a wide range accurately. Simulation results validate the excellent control performance of the CVSPI and the accuracy of the enhanced MRAS over a wide speed range.

In the speed control system of Interior Permanent Magnet Synchronous Motor (IPMSM) without a speed sensor, the speed under the traditional PI control suffers from poor tracking performance and step response overshoot. This paper proposes a Compound Variable Structure PI (CVSPI) controller to improve the system control performance. It can choose whether to include an integral term according to the size of the system deviation to speed up the response. It also introduces a Model Reference Adaptive System (MRAS) speed observer in the controller to estimate the speed and adaptively adjust the size of the anti-integration saturation gain to improve the dynamic response following performance and immunity of the system. A feed-forward link is added for a given input differential to achieve an accurate answer to time-varying inputs. As the linear compensation matrix of the conventional MRAS is a unit matrix, the speed can only be accurately observed in a specific speed range. In this paper, a new linear compensation matrix is designed, and a new speed adaptive law is derived, allowing the improved MRAS to measure speed over a wide range accurately. Simulation results validate the excellent control performance of the CVSPI and the accuracy of the enhanced MRAS over a wide speed range.