The global demand for energy has been steadily increasing due to population growth, urbanization, and industrialization. Numerous researchers worldwide are striving to create precise forecasting models for predicting energy consumption to manage supply and demand effectively. In this research, a time-series forecasting model based on multivariate multilayered long short-term memory (LSTM) is proposed for forecasting energy consumption and tested using data obtained from commercial buildings in Melbourne, Australia: the Advanced Technologies Center, Advanced Manufacturing and Design Center, and Knox Innovation, Opportunity, and Sustainability Center buildings. This research specifically identifies the best forecasting method for subtropical conditions and evaluates its performance by comparing it with the most used methods at present, including LSTM, bidirectional LSTM, and linear regression. The proposed multivariate multilayered LSTM model was assessed by comparing mean average error (MAE), root-mean-square error (RMSE), and mean absolute percentage error (MAPE) values with and without labeled time. Results indicate that the proposed model exhibits optimal performance with improved precision and accuracy. Specifically, the proposed LSTM model achieved a decrease in MAE by 30%, RMSE by 25%, and MAPE by 20% compared to the LSTM method. Moreover, it outperformed the bidirectional LSTM method with a reduction in MAE by 10%, RMSE by 20%, and MAPE by 18%. Furthermore, the proposed model surpassed linear regression with a decrease in MAE by 2%, RMSE by 7%, and MAPE by 10%. These findings highlight the significant performance increase achieved by the proposed multivariate multilayered LSTM model in energy consumption forecasting.

This paper proposes an algorithm for transmitting and reconstructing the estimated point cloud using temporally estimating a dynamic point cloud sequence. When a non-rigid 3D point cloud sequence (PCS) is input, the sequence is divided into groups of point cloud frames (PCF), and a key PCF is selected. After the 3D skeleton is predicted through 3D pose estimation, the motion of the skeleton is estimated by analyzing the joints and bones of the 3D skeleton. For the deformation of the non-rigid human PC, the 3D PC model is transformed into a mesh model, and the key PCF is rigged using the 3D skeleton. After deforming the key PCF into the target PCF utilizing the motion vector of the estimated skeleton, the residual PC between the motion compensation PCF and the target PCF is generated. If there is a key PCF, the motion vector of the target PCF, and a residual PC, the target PCF can be reconstructed. Just as compression is performed using pixel correlation between frames in a 2D video, this paper compresses 3D PCF by estimating the non-rigid 3D motion of a 3D object in a 3D PC. The proposed algorithm can be regarded as an extension of the 2D motion estimation of a rigid local region in a 2D plane to the 3D motion estimation of a non-rigid object (human) in 3D space. Experimental results show that the proposed method can successfully compress 3D PC sequences. If it is used together with a PC compression technique such as MPEG PCC (point cloud compression) in the future, a system with high compression efficiency may be configured.

This article presents a forecast model that uses a hybrid architecture of recurrent neural networks (RNN) with surface neural networks (ANN), based on historical records of exported active energy (EAE) and weather data. Two types of models were developed: the first type includes six models that use EAE records and weather variables as inputs, while the second type includes eight models that use only weather variables. Different metrics were applied to assess the performance of these models, and the best model of each type was selected. Finally, a comparison of the performance between the selected models of both types is presented, and they are validated with real data provided by a solar plant, achieving acceptable levels of accuracy. The selected model of the first type has an RMSE of 0.19, MSE of 0.03, MAE of 0.09, a correlation coefficient of 0.96, and a determination coefficient of 0.93. The other selected model of the second type showed lower precision in the metrics (RMSE = 0.24, MSE = 0.06, MAE = 0.10, Corr. Coef. = 0.95, and Det. Coef. = 0.90). Both models demonstrated good performance and acceptable accuracy in forecasting the weekly photovoltaic energy production of the solar plant.

Nowadays, there is extensive production and use of plastic materials for different industrial activities. These plastics, either from their primary production sources or through degradation processes of the plastics themselves, can contaminate the ecosystem with micro and nanoplastics. Once in the aquatic environment, these microplastics can be the basis for the adsorption of chemical pollutants, favoring that these chemical pollutants disperse more quickly in the environment and can affect living beings. Due to the lack of information on adsorption, three machine learning models (random forest, support vector machine, and artificial neural network) to predict different microplastic/water partition coefficients (log Kd) were developed using two different approximations (based on the number of input variables). The best-selected machine learning models present, in general, correlation coefficients upper than 0.92 in the query phase, which indicate that these type of models could be used for a rapid estimation of the absorption of organic contaminants on microplastics.

The passenger prediction flow is very significant to transportation sustainability. This is due to some chaos of traffic jams encountered by the road users during their movement to the offices, schools, or markets at earlier of the days and during closing periods. This problem is peculiar to the transportation system of the Federal University of Technology Minna, Nigeria. However, the prevailing technique of passenger flow estimation is non-parametric which depends on the fixed planning and is easily affected by noise. In this research, we proposed the development of a hybrid intelligent passenger frequency prediction model using the Auto-Regressive Integrated Moving Average (ARIMA) linear model, Convolutional Neural Network (CNN), and Kalman Filter Algorithm (KFA). The passengers’ frequency of arrival at the bus terminals is obtained and enumerated through the closed-circuit television (CCTV) and demonstrated using the Markovian Queueing Systems Model (MQSM). The ARIMA model was used for learning and prediction and compared the result with the combined techniques of using CNN-KFA. The autocorrelation coefficient functions (ACF) and partial autocorrelation coefficient functions (PACF) are used to examine the stationary data with different features. The performance of the models was analyzed and evaluated in describing the short-term passenger flow frequency at each terminal using the Mean Absolute Percentage Error (MAPE) and Mean Squared Error (MSE) values. The CNN-Kalman-filter model was fitted into the short-term series and the MAPE values are below 10%. The Mean Square Error (MSE) shows that the CNN-Kalman Filter model has the overall best performance with 83.33% of the time better than the ARIMA model and provides high accuracy in forecasting.

A time integration scheme based on semi-Lagrangian advection and Laplace transform adjustment has been implemented in a baroclinic primitive equation model. The semi-Lagrangian scheme makes it possible to use large time steps. However, errors arising from the semi-implicit scheme increase with the time step size. In contrast, the errors using the Laplace transform adjustment remain relatively small for typical time steps used with semi-Lagrangian advection. Numerical experiments confirm the superior performance of the Laplace transform scheme relative to the semi-implicit reference model. The algorithmic complexity of the scheme is comparable to the reference model, making it computationally competitive, and indicating its potential for integrating weather and climate prediction models.

Achieving global goals on sustainable nutrition, health, and wellbeing will depend on delivering enhanced diets to humankind. This will require, among others, instantaneous access to information on food quality at key points within agri-food systems. Although stationary methods are usually used to quantify grain quality (wet-lab chemistry, benchtop NIR spectrometer); these do not suit many required user-cases, such as stakeholders in decentralized agri-food-chains that are typical for emerging economies. Therefore, we explored new technologies and models that might aid these particular user-cases. For this purpose, we generated the NIR spectra of 328 grain samples from multiple cereals (finger millet, foxtail millet, maize, pearl millet, sorghum) with a standard benchtop NIR Spectrometer (DS2500, FOSS) and a novel mobile NIR-based sensor (HL-EVT5, Hone). We explored a range of classical deterministic and novel machine learning (ML)-driven models to build calibrations out of the NIR spectra. We were able to build relevant calibrations out of both types of spectra. At the same time, ML-based methods enhanced the prediction capacity of calibration models compared to classical deterministic methods. We also documented that the prediction of grain protein content based on NIR spectra generated by a mobile sensor (HL-EVT5, Hone) was highly relevant for quantitative protein predictions (R2 = 0.91, RMSE = 0.97, RPD = 3.48). Thus, the findings of this study lay the foundations on which to expand the utilization of NIR spectroscopy applications for agricultural research and development.

To achieve the near zero emission of wastewater in the flue gas desulfurization (FGD) system in coal-fired power plant and better utilize the exhaust heat from flue gas, a feasible technology of spraying FGD wastewater in the flue duct for evaporation is discussed in the present study. A full-scale influencing factor investigation on the wastewater droplet evaporation performance is established under the Eulerian-Lagrangian model numerically. The dominant factors, including the characters of wastewater droplets, flue gas and the spray nozzles were analyzed under different conditions, respectively. Considering the multiple factors and conditions in the process, a Least-Square support vector machine (LSSVM) model is introduced to predict the evaporation rate based on the numerical results. Conclusions are made that the flue gas temperature and droplet diameter are of great importance in the evaporation process. The spray direction of droplet parallel with the flue gas flow direction is profitable for the dispersion of droplet, resulting the maximal evaporation rate. A double-nozzle arrangement optimized with relatively small flow rate is recommended. The LSSVM model can accurately predict the evaporation rate using the numerical results with different conditions.

We describe a novel system for online prediction of lead seizures from long-term intracranial electroencephalogram (iEEG) recordings for canines with naturally occurring epilepsy. This study adopts new specification of lead seizures, reflecting strong clustering of seizures in observed data. This clustering results in fewer lead seizures (~7 lead seizures per dog), and hence new challenges for online seizure prediction, that are addressed in the proposed system. In particular, machine learning part of the system is implemented using the Group Learning method suitable for modeling sparse and noisy seizure data. In addition, several modifications for the proposed system are introduced to cope with non-stationarity of noisy iEEG signal. They include: (1) periodic re-training of SVM classifier using most recent training data; (2) removing samples with noisy labels from training data; (3) introducing new adaptive post-processing technique for combining many predictions made for 20-second windows into a single prediction for 4 hr segment. Application of the proposed system requires only 2 lead seizures for training the initial model, and results in high prediction performance for all four dogs (with mean 0.84 sensitivity, 0.27 time-in-warning, and 0.78 false-positive rate per day). Proposed system achieves accurate prediction of lead seizures during long-term test periods, 3–16 lead seizures during 169–364 days test period, whereas earlier studies did not differentiate between lead vs. non-lead seizures and used much shorter test periods (~few days long).

Incident solar radiation (insolation) passing through the forest canopy to the ground surface is either absorbed or scattered. This phenomenon, known as radiation attenuation, is measured using the extinction coefficient (K). The amount of radiation at the ground surface of a given site is effectively controlled by the canopy’s surface and structure, determining its suitability for plant species.Menhinick’s and Simpson biodiversity indexes were selected as spatially explicit response variables for the regression equation using canopy structure metrics as predictors. Independent variables include modeled area solar radiation, LiDAR derived canopy height, effective leaf area index data derived from multi-spectral imagery, and canopy strata metrics derived from LiDAR point-cloud data. The results support the hypothesis that, 1.) canopy surface and strata variability may be associated with understory species diversity due to habitat partitioning and radiation attenuation, and that, 2.) such a model can predict both this relationship and biodiversity clustering.The study data yielded significant correlations between predictor and response variables and was used to produce a multiple-linear model comprising canopy relief, texture of heights, and vegetation density to predict understory plant diversity. When analyzed for spatial autocorrelation, the predicted biodiversity data exhibited non-random spatial continuity.

Energy harvesting from wind turbines has been explored by researchers for more than a century from conventional turbines up to the latest bladeless turbines. Amongst these bladeless turbines, vortex bladeless wind turbine (VBT) harvests energy from oscillation of a turbine body. Due to the novelty of this science and the widespread researches around the world, one of the most important issues is to optimize and predict produced power. To enhance the produced output electrical power of VBT, the fluid-solid interactions (FSI) were analyzed to collect a dataset for predicting procedure. Long short-term memory (LSTM) method has been used to predict the produced power of VBT from the collected data. The reason of choosing LSTM from various artificial neural network methods is that the parameters of VBT study are all time- dependent and the LSTM is one of the most accruable algorithms for predicting time series data. In order to find the relationship between the parameter and the variables used in this research, a correlation matrix was presented. According to the value of 0.3 for the root mean square error (RMSE), a comparative analysis between the simulation results and its prediction shows that the LSTM method is very accurate for these types of research. Furthermore, the LSTM method has significantly reduced the computation time so that the prediction time of desired values has been reduced from an average of 2 and a half hours to two minutes. Also, one of the most important achievements of this study is to suggest a mathematical relation of VBT output power which helps to extend it in a different size of VBT with a high range of parameter variations.

During the night between 9 and 10 September 2017, multiple flash floods associated to a heavy-precipitation event affected the town of Livorno, located in Tuscany, Italy. Accumulated precipitation exceeding 200 mm in two hours, associated with a return period higher than 200 years, caused all the largest streams of the Livorno municipality to flood several areas of the town. We used the limited-area Weather Research and Forecasting (WRF) model, in a convection-permitting setup, to reconstruct the extreme event leading to the flash floods. We evaluated possible forecasting improvements emerging from the assimilation of local ground stations and X- and S-band radar data into the WRF, using the configuration operational at the meteorological center of Tuscany region (LaMMA) at the time of the event. Simulations were verified against weather station observations, through an innovative method aimed at disentangling the positioning and intensity errors of precipitation forecasts. By providing more accurate descriptions of the low-level flow and a better assessment of the atmospheric water vapour, the results demonstrate that assimilating radar data improved the quantitative precipitation forecasts.

Link prediction is an iconic problem in complex networks because deals with the ability to predict nonobserved existing or future parts of the network structure. The impact of this prediction on real applications can be disruptive: from prediction of covert links between terrorists in their social networks to repositioning of drugs in molecular diseasome networks. Here we compare: (1) an ensemble meta-learning method (Ghasemian et al.), which uses an artificial intelligence (AI) stacking strategy to create a single meta-model from hundreds of other models; (2) a structural predictability method (SPM, Lü et al.), which relies on a theory derived from quantum mechanics and does not assume any model; (3) a modelling rule named Cannistraci-Hebb (CH, Muscoloni et al.), which relies on one brain-bioinspired model adapting to the intrinsic network structure.We conclude that brute-force stacking of algorithms by AI does not perform better than (and is often significantly outperformed by) SPM and one simple brain-bioinspired rule such as CH. This agrees with the Gödel incompleteness: stacking is optimal but incomplete, you cannot squeeze out more than what is already in your features. Hence, we should also pursue AI that resembles human-like physical ‘understanding’ of simple generalized rules associated to complexity. The future might be populated by AI that ‘steals for us the fire from Gods’, towards machine intelligence that creates new rules rather than stacking the ones already known.

Accurate forecasts of ocean waves energy can not only reduce costs for investment but it is also essential for management and operation of electrical power. This paper presents an innovative approach based on the Long Short Term Memory (LSTM) to predict the power generation of an economical wave energy converter named “Searaser”. The data for analyzing is provided by collecting the experimental data from another study and the exerted data from numerical simulation of searaser. The simulation is done with Flow-3D software which has high capability in analyzing the fluid solid interactions. The lack of relation between wind speed and output power in previous studies needs to be investigated in this field. Therefore, in this study the wind speed and output power are related with a LSTM method. Moreover, it can be inferred that the LSTM Network is able to predict power in terms of height more accurately and faster than the numerical solution in a field of predicting. The network output figures show a great agreement and the root mean square is 0.49 in the mean value related to the accuracy of LSTM method. Furthermore, the mathematical relation between the generated power and wave height was introduced by curve fitting of the power function to the result of LSTM method.

Artificial intelligence (AI) is a versatile term that is a conclusive remedy to solve the problem using past rational data after deep contemplation using these terms i-e basic statistics, carving data, familiarity with common AI algorithms. Seafood especially tiger prawn export as a busi-ness will provide enormous foreign exchange to any country if the farmers overcome the corre-lated vulnerabilities in prawn farming. This research is elucidating lacking in Tiger prawn (TP) farming like curbing of Oxygen, pH, water temperature, and nutrients, etc. Moreover, hatchery statistics in terms of juveniles will depict this study's clear picture of curbed aquaculture. For normative decisions, the Analytical Hierarchical Process (AHP) is used. The problem which has been faced by local prawn farmers that there is a stagnant TP growth in ponds, the reason is the predominant sensitivity factor in TP. For this reason, they need indemnification of thirteen fac-tors with natural resources to get the plausible results to get calmness in their lives. This study will solely focus on the TP growth model, and the monitoring effect will be established by the Artificial Intelligence algorithm. This study will employ the AHP, 0-1 scaling method, data cura-tion techniques, and ecological statistics. The life of Tiger Prawn (TP) depends upon these factors mainly, a) Physical and b) Chemical parameters. Physical parameters contain environment (E) provided to TP like season (S) and temperature (T) etc. whereas the quality of Ammonia NH3 (N) from fish waste, Oxygen level (O), and water quality hard & soft (W) lies in chemicals do-main. This research will Elucidate the factors which cause conceptual muddles in the aquamarine life of TP, for this reason, Statistical tools will assess the current result, forecast the gap. AHP will analyze the domain inputs, circumspect ramification which will depict visceral factors, later results depict which pond suits the TP. In curtail, these factors will be curbed to improve the growth of TP in a control conditioned environment.

The study takes into account different classes of tunnel boring machines (TBMs), with the aim of identifying correlation models which are meant to estimate, at a preliminary design phase, the construction time of a tunnel and to evaluate the mechanical and operational parameters of the TBMs, starting from the knowledge of the tunnel length and/or the excavation diameter. To achieve this goal, first of all a database was created, thanks to the collection of the most meaningful technical parameters from a large number of tunnels; afterward, it was statistically analysed through Microsoft Excel. In a first phase, forecasting models were identified for the three types of machines investigated, separately for compact rocks (open TBM) and fractured rocks (single and double shield TBM). Then, the mechanical parameters collected through the database were analysed, with the aim of obtaining models that take into account, in addition to the type of TBM, the geological aspect, and the type of rock characterising the rock mass. Finally, the validation of the study was proposed in a real case, represented by the Moncenisio base tunnel, a work included in the new Turin–Lyon connection line. The estimated values were compared with the real ones, in order to verify the accuracy of the experimental models identified.

In this paper a novel and flexible solution for fault prediction based on data collected from Supervisory Control and Data Acquisition (SCADA) system is presented. Generic fault/status prediction is offered by means of a data driven approach based on a self-organizing map (SOM)and the definition of an original Key Performance Indicator (KPI). The model has been assessed on a park of three photovoltaic (PV) plants with installed capacity up to 10 MW, and on more than sixty inverter modules of three different technology brands. The results indicate that the proposed method is effective in predicting incipient generic faults in average up to 7 days in advance with true positives rate up to 95%. The model is easily deployable for on-line monitoring of anomalies on new PV plants and technologies, requiring only the availability of historical SCADA data, fault taxonomy and inverter electrical datasheet.

Urban growth in various cities across the world, especially in developing countries, leads to land use change. Thus, predicting future urban growth in the most rapidly growing region of Nigeria becomes a significant endeavor. This study analyzes land use and land cover (LULC) change and predicts the future urban growth of the Lagos metropolitan region, using Cellular Automata (CA) model. To achieve this, the GlobeLand30 datasets from years 2000 and 2010 were used to obtain LULC maps, which were utilized for modeling and prediction. Change analysis and prediction for LULC scenario for 2030 were performed using LCM and CA_Markov chain modeling. The results show a substantial growth of artificial surfaces, which will cause further reductions in cultivated land, grassland, shrubland, wetland, and waterbodies. There was no appreciable impact of change for bare land, as its initial extent of cover later disappeared completely. Additionally, artificial surfaces/urban growth in Lagos expanded to the neighboring towns and localities in Ogun State during the study period, and it is expected that such growth will be higher in 2030. Lastly, the study findings will be beneficial to urban planners and land use managers in making key decisions regarding urban growth and improved land use management in Nigeria.

Indian cities are increasingly becoming susceptible to PM10 induced health effects which have become a matter of concern for the policymakers of the country. Air pollution is engulfing the comparatively smaller cities as the rapid pace of urbanization, and economic development seems not to lose steam ever. A review of air pollution of 28 cities of India, which includes tier-I, II, and III cities of India, found to have grossly violated both WHO and NAAQS standards in respect of acceptable daily average PM10 concentrations by a wide margin. Predicting the city level PM10 concentrations in advance and accordingly initiate prior actions is an acceptable solution to save the city dwellers from PM10 induced health hazards. Predictive ability of three models, linear MLR, nonlinear MLP (ANN), and nonlinear CART, for one day ahead PM10 concentration forecasting of tier-II Guwahati city, were tested with 2016-2018 daily average observed climate data, PM10, and gaseous pollutants. The results show that the non-linear algorithm MLP with feedforward backpropagation network topologies of ANN class, giving the best prediction value when compared with linear MLR and nonlinear CART model. ANN (MLP) approach, therefore, may be useful to effectively derive a predictive understanding of one day ahead PM10 concentration level and thus provide a tool to the policymakers for improving decision-making associated with air pollution and public health.

Water resource is considered as a significant factor in development of regional environment and society. Water consumption prediction can provide important decision basis for the regional water supply scheduling optimisations. According to the periodicity and randomness nature of the daily water consumption data, a Markov modified autoregressive moving average (ARIMA) model is proposed in this study. The proposed model, combined with the Markov chain, can correct the prediction error, reduce the continuous superposition of prediction error, and improve the prediction accuracy of future daily water consumption data. The daily water consumption data of different monitoring points are used to verify the effectiveness of the model, and the future water consumption is predicted, in the study area. The results show that the proposed algorithm can effectively reduce the prediction error compared to the ARIMA.

In the present paper, an aerodynamic investigation of a high-speed train is performed. In the first section of this article, a generic high-speed train against a turbulent flow is simulated, numerically. The Reynolds-Averaged Navier-Stokes (RANS) equations combined with the SST turbulence model are applied to solve incompressible turbulent flow around a high-speed train. Flow structure, velocity and pressure contours and streamlines at some typical wind directions are the most important results of this simulation. The maximum and minimum values are specified and discussed. Also, the pressure coefficient for some critical points on the train surface is evaluated. In the following, the wind direction influence the aerodynamic key parameters as drag, lift, and side forces at the mentioned wind directions are analyzed and compared. Moreover, the effects of velocity changes (50, 60, 70, 80 and 90 m/s) are estimated and compared on the above flow and aerodynamic parameters. In the second section of the paper, various data-driven methods including Gene Expression Programming (GEP), Gaussian Process Regression (GPR), and random forest (RF), are applied for predicting output parameters. So, drag, lift and side forces and also minimum and a maximum of pressure coefficients for mentioned wind directions and velocity are predicted and compared using statistical parameters. Obtained results indicated that RF in all coefficients of wind direction and most coefficients of free stream velocity provided the most accurate predictions. As a conclusion, RF may be recommended for the prediction of aerodynamic coefficients.

In this paper, we propose the set-membership quaternion normalized least-mean-square (SM-QNLMS) algorithm. For this purpose, first, we review the quaternion least-mean-square (QLMS) algorithm, then go into the quaternion normalized least-mean-square (QNLMS) algorithm. By having the QNLMS algorithm, we propose the SM-QNLMS algorithm in order to reduce the update rate of the QNLMS algorithm and avoid updating the system parameters when there is not enough innovation in upcoming data. Moreover, the SM-QNLMS algorithm, thanks to the time-varying step-size, has higher convergence rate as compared to the QNLMS algorithm. Finally, the proposed algorithm is utilized in wind profile prediction and quaternionic adaptive beamforming. The simulation results demonstrate that the SM-QNLMS algorithm outperforms the QNLMS algorithm and it has higher convergence speed and lower update rate.

Software defect prediction is an important means to guarantee software quality. Because there are no sufficient historical data within a project to train the classifier, cross-project defect prediction (CPDP) has been recognized as a fundamental approach. However, traditional defect prediction methods using feature attributes to represent samples, which can not avoid negative transferring, may result in poor performance model in CPDP. This paper proposes a multi-source cross-project defect prediction method based on dissimilarity space ( DM-CPDP). This method first uses the density-based clustering method to construct the prototype set with the cluster center of samples in the target set. Then, the arc-cosine kernel is used to form the dissimilarity space, and in this space the training set is obtained with the earth mover’s distance (EMD) method. For the unlabeled samples converted from the target set, the KNN algorithm is used to label those samples. Finally, we use TrAdaBoost method to establish the prediction model. The experimental results show that our approach has better performance than other traditional CPDP methods.

Selective laser melting (SLM) is one of the widely used techniques in metallic additive manufacturing, in which high-density laser powder is utilized to selectively melting layers of powders to create geometrically complex parts. Temperature distribution and molten pool geometry directly determine the balling effect, and concentrated balling phenomenon significantly deteriorates surface integrity and mechanical properties of the part. Finite element models have been developed to predict temperature distribution and molten pool geometry, but they were computationally expensive. In this paper, the three-dimensional temperature distributions are predicted by analytical models using point moving heat source and semi-ellipsoidal moving source respectively. The molten pool dimensions under various process conditions are obtained from the three-dimensional temperature predictions and experimentally validated. Ti-6Al-4V alloy is chosen for the investigation. Good agreements between the predictions and the measurements are observed. The presented models are also suitable for other metallic materials in the SLM process.

This study was undertaken to forecast waste generation rates of accommodation sector of North Cyprus as a case. Three predictor models including multiple linear regression (MLR), artificial neural networks (ANNs) and central composite design (CCD) were applied to predict the waste generation rate during the lean and peak seasons. ANN showed highest prediction performance, specifically, lowest values of the standard error of prediction (SEP = 2.153), mean absolute error (MAE=1.378) and highest R2 value (0.998) confirmed the accuracy of the model. The analysed wastes were categorised into recyclable, general waste and food residues. The authors estimated the total waste generated during the lean season as 2010.5 kg/day, in which large-sized hotel accounted for largest fraction (66.7%), followed by the medium hotels (19.4%) and guesthouse accounted for smallest part (2.6%). During the peak season, about 49.6% increases in the waste generation rates were obtained. Interestingly, 45% of the wastes were generated by the British tourists while the least waste was generated by African tourists (7.5%). The ANN predicted that the small and large hotels would produce 5.45 and 22.24 tons of waste by the year 2020, respectively. The findings herein are promising and useful in establishing a sustainable waste management system.

Clinical metagenomics (CMg), referred to as the application of next-generation sequencing (NGS) to clinical samples, is a promising tool for the diagnosis of hospital-acquired pneumonia (HAP). Indeed, CMg allows identifying pathogens and antibiotic resistance genes (ARGs), thereby providing the information required for the optimization of the antibiotic regimen. Hence, provided that CMg would be faster than conventional culture, the probabilistic regimen used in HAP could be tailored faster, which should lead to an expected decrease of mortality and morbidity. While the inference of the antibiotic susceptibility testing from metagenomic or even genomic data is challenging, a limited number of antibiotics are used in the probabilistic regimen of HAP (namely beta-lactams, aminoglycosides, fluoroquinolones, glycopeptides and oxazolidinones). Accordingly in the perspective of applying CMg to the early diagnostic of HAP, we aimed at reviewing the performances of whole genomic sequencing (WGS) of the main HAP-causing bacteria (Enterobacteriaceae, Pseudomonas aeruginosa, Acinetobacter baumannii, Stenotrophomonas maltophilia and Staphylococcus aureus) for the prediction of susceptibility to the antibiotic families advocated in the probabilistic regimen of HAP.

In the current study, the failure behavior of retrofitted steel structures was studied experimentally and theoretically with steel/CFRP double strap joints (DSJs) under quasi-static tensile loading. A series of DSJs with different bonding lengths are also considered and examined to experimentally assess the effective bond length. To predict the failure load values of the tested specimens, a new stress-based criterion, namely the point stress (PS) criterion is proposed. Although some theoretical predictive modelling for the strength between steel/CFRP joints under various loading conditions has been presented, in this work by using the new proposed approach, one can calculate rapidly and conveniently the failure loads of the steel/CFRP specimens. Furthermore, to assess the validity of the new proposed criterion, further experimental data on steel/CFRP DSJs available in the open literature are predicted using the PS criterion. Finally, it was found that a good agreement exists between the experimental results and the theoretical predictions based on the PS criterion.

Amidst the escalating demands for efficient Intelligent Transportation Systems (ITS) management, the significance of accurate Origin-Destination (OD) data prediction has emerged as a paramount concern, given its indispensable role in the ITS domain. This paper introduces a groundbreaking integrated model, creatively fusing the unique strengths of Graph Convolutional Network (GCN), Residual Neural Network (ResNet), and Long Short-Term Memory Network (LSTM) into a single architecture, which we name GraphResLSTM, to exploit road segment average speed data for OD prediction. Compared with conventional road segment traffic volume data, average speed data is more readily available, significantly reducing the data accessibility barrier for OD prediction. We underscore the critical role of selection of key road segments and employs a combination of Entropy Weight Method and Technique for Order Preference by Similarity to Ideal Solution (TOPSIS) to identify 41 representative road segments from the experimental road network. In the experimental phase, we simulate 86400000 seconds of traffic conditions, generating a total of 1440000 data records. Utilizing these simulated data, we design and conduct comparative experiments between models as well as data types. The results demonstrate that both the GraphResLSTM model and road segment average speed data outperform other models and data types notably in OD prediction tasks.

In metal additive manufacturing (AM), precise temperature field prediction is crucial for process monitoring, automation, control, and optimization. Traditional methods, primarily offline and data-driven, struggle with adapting to real-time changes and new process scenarios, which limits their applicability for effective AM process control. To address these challenges, this paper introduces the first physics-informed (PI) online learning framework specifically designed for temperature prediction in metal AM. Utilizing a physics-informed neural network (PINN), this framework integrates a neural network architecture with physics-informed inputs and loss functions. Pretrained on a known process to establish a baseline, the PINN transitions to an online learning phase, dynamically updating its weights in response to new, unseen data. This adaptation allows the model to continuously refine its predictions in real-time. By integrating physics-informed components, the PINN leverages prior knowledge about the manufacturing processes, enabling rapid adjustments to process parameters, geometries, deposition patterns, and materials. Empirical results confirm the robust performance of this PI online learning framework in accurately predicting temperature fields for unseen processes across various conditions. It notably surpasses traditional data-driven models, especially in critical areas like the Heat Affected Zone (HAZ) and melt pool. The PINN’s use of physical laws and prior knowledge not only provides a significant advantage over conventional models but also ensures more accurate predictions under diverse conditions. Furthermore, our analysis of key hyper-parameters—learning rate and batch size of the online learning phase—highlights their roles in optimizing the learning process and enhancing the framework’s overall effectiveness. This approach demonstrates significant potential to improve the online control and optimization of metal AM processes.

This study investigates the correlation between the California Bearing Ratio (CBR) and the Dynamic Cone Penetrometer (DCP) for subgrade soil analysis. The paper aims to provide practical equations for predicting CBR values from DCP test results, enhancing the efficiency of soil assessments in engineering practice. By analyzing test data and proposing correlations for different soil groups, the study introduces recalibrated correlations that demonstrate high accuracy in predicting CBR values. The newly proposed equations offer reliable predictions with R2 values of 0.89, 0.92, and 0.94 for clean sand, silty sand or sandy silt, and cohesive soil, respectively. These correlations serve as valuable tools for engineers, enabling rapid and accurate CBR estimations for improved decision-making in various engineering projects.

Accurate and reliable mid-long runoff prediction (MLTRP) is of great importance in water re-sources management. However the MLTRP is not suitable in each basin and how to evaluate the applicability of MLTRP is still a question. Therefore, the total mutual information (TMI) index is developed in this study based on the predictor selection method using mutual information (MI) and partial MI (PMI). The relationship between the TMI and the predictive performance of five models is analyzed by applying five models in 222 forecasting scenarios in Australia. The results over 222 forecasting scenarios demonstrate that, compared with the MI, the developed TMI index can better represent the available information in the predictors, and has more significant negative correlation with the RRMSE with the correlation coefficient between -0.62 and -0.85. This means the model's predictive performance will become better along with the increase of TMI, and there-fore the developed TMI index can be used to evaluate the applicability of MLTRP. When TMI is more than 0.1, the available information in the predictors can support the construction of MLTRP models. In addition, the TMI is used to partly explain the difference of predictive performance among five models. In general, the complex models, which can better utilize the contained infor-mation, are more sensitive to the TMI, and have more significant improvement in terms of predic-tive performance along with the increase of TMI. This research can provide support for the study of MLTRP.

Non-neural Machine Learning (ML) and Deep Learning (DL) are used to predict system failures in industrial maintenance. However, only a few studies have assessed the effect of varying the amount of past data used to make a prediction and the extension in the future of the forecast. This study evaluates the impact of the size of the reading window and of the prediction window on the performances of models trained to forecast failures in three data sets of (1) an industrial wrapping machine working in discrete sessions, (2) an industrial blood refrigerator working continuously and (3) a nitrogen generator working continuously. A binary classification task assigns the positive label to the prediction window based on the probability of a failure to occur in such an interval. Six algorithms (logistic regression, random forest, support vector machine, LSTM, ConvLSTM and Transformers) are compared using multivariate time series. The dimension of the prediction windows plays a crucial role and the results highlight the effectiveness of DL approaches in classifying data with diverse time-dependent patterns preceding a failure and the effectiveness of ML approaches in classifying similar and repetitive patterns preceding a failure.

In the era of mounting water scarcity, particularly in arid regions, the agricultural sector is striving to optimize the water resource management practices. Treated wastewater (TWW) has emerged as a viable alternative to freshwater for irrigation, offering a sustainable solution to water conservation. However, ensuring the safety and quality of TWW is paramount to safeguard for both crop health and environmental integrity. Electrical conductivity (EC), a critical factor in assessing TWW suitability for irrigation, can significantly impact crop yields and soil health since it is directly linked to the concentration of dissolved salts and ions. Therefore, this study delves into the development of advanced predictive models for EC assessment by employing supervised machine learning (ML) techniques like the Support Vector Regression (SVR), Adaptive Network-based Fuzzy Inference System (ANFIS), and Multiple Linear Regression (MLR). The TWW samples collected from Al-Qatif area, Saudi Arabia were assessed in the lab through a sensor-based real-time monitoring system integrated with Internet of Things (IoT) network and a multiprobe device. The key water quality parameters assessed involved, temperature (T), pH, Oxidation Reduction Potential (ORP), Resistivity (RES), Total Dissolved Solids (TDS), Salinity and Turbidity which served as the foundation for these models, given their profound influence on and their anticipated impact on EC levels. Following feature selection, two distinct model combinations were identified for the SVR, ANFIS and MLR models. Furthermore, to evaluate prediction performance, four statistical criteria, including coefficient of determination (R²), correlation coefficient (R), mean square error (MSE), and root mean square error (RMSE), were employed. Overall, the comparative performance results proved that ANFIS-M2 indicated the strongest predictive capability with the R² value of 0.99572 and 0.75145 and the RMSE values of 0.00965 and 0.01134, respectively in both calibration and verification stages.

This paper proposes training improvement methods of artificial neural networks (ANN) trajectory predictors. First, a dynamic power system time-series trajectory is split into several different segments to simplify the original ANN training problem. Moreover, the time-derivative of the trajectory is included to obtain an augmented loss function. Compared to previous studies which mainly focused on increasing the prediction accuracy, the aim of these novel techniques is to reduce the computational burden where the ANN output performance is still acceptable. The effectiveness of the developed methods is validated based on the WSCC three-machine nine-bus and IEEE 39-bus system models. The mean absolute error (MAE) and trajectory prediction results are analyzed, in which the numbers of neurons, hidden layers, and training epochs are constrained during the ANN training process. Rotor-angle difference between generators and the system frequency are investigated as the dynamic trajectories of the power system models. It is revealed that when the ANN architecture and epochs are constrained, the MAE results can be reduced, and the ANN training results can better reflect the original trajectory using the improvement approaches.

Pedestrian object detection plays a significant role in intelligent systems such as intelligent traffic and monitoring. Traditional machine learning methods on pedestrian detection have shown various drawbacks, \eg{} low accuracy, slow speed, \etc The Convolutional Neural Network (CNN) based object detection algorithms have demonstrated remarkable advantages in the field of pedestrian detection. However, the mainstream CNNs still face the problems of slow speed and low detection accuracy, especially on small and occluded targets from aerial perspective. In this paper, we propose Multi-Scale Attention YOLO (MSA-YOLO) detection algorithm to address the above issues. MSA-YOLO includes a Squeeze, Excitation and Cross Stage Partial (SECSP) channel attention module for CNNs to extract richer pedestrian features with a small number of extra parameters. It also contains a multi-scale prediction module to capture the information among different pedestrian scales, which can recognize the small objects with higher accuracy and significantly reduce the missed detection. To sufficiently evaluate our proposed model, we manually collect and annotate a new benchmark dataset, Luoyang Pedestrian Dataset \footnote{The dataset can be downloaded through this anonymous link: \url{https://drive.google.com/drive/folders/13po1FX7Qk5RDgb60-dzOi74cq_kqDJtM?usp=sharing} }, which has much more sample annotations, features, scenes and image view angles than the existing benchmark datasets. In addition, the images in our dataset have higher resolution than most of benchmark pedestrian detection datasets, which can provide more detailed features of pedestrians and thus improve the model performance. When tested on Luoyang Pedestrian Dataset, our proposed MSA-YOLO algorithm significantly outperform the most commonly used baseline models with almost the same model size. This shows the efficiency of our proposed model. (The code and new dataset will be released to the public later.)

The new energy structure needs to balance energy security and dual carbon goals, which has brought major challenges to coal-fired power plants, the pollution reduction and carbon emissions reduction of coal-fired power plants will be a key task in the future. This article proposes an optimization operation of electrostatic precipitators(ESP), based on the working mechanism and historical data of ESP, voltage-current characteristic model and outlet dust concentration prediction model are constructed by deep learning algorithm, Particle Swarm Optimization(PSO) is used to achieve the optimal energy consumption while ensuring stable outlet dust concentration. By training with historical data collected on site, accurate prediction of secondary current and outlet dust concentration of ESP has been achieved, the Mean Absolute Percentage Error(MAPE) of secondary current is less than 1.5%, and the MAPE of outlet dust concentration of ESP on the test set is less than 5.2%. Finally, the optimization experiment is carried out in a 330MW coal-fired power plants, the results showed that the fluctuation of the outlet dust concentration is more stable, and the energy saving is about 43% after optimization, according to the annual operation of 300 days, the annual average carbon reduction is approximately 2621.34 tons. This method is effective and can be applied widely.

This work presents a heat transfer and boiling model that computes the evolution of the temperature field in a representative steel workpiece quenched from 850 or 930°C by immersion in water flowing at average velocities of 0.2 or 0.6 m/s, respectively. Under these conditions, all three boiling regimes were present during cooling: stable vapor film, nucleate boiling, and single-phase convection. The model was based on the numerical solution of the heat conduction equation coupled to the solution of the energy and momentum equations for water. The mixture phase approach was adopted using the Lee model to compute the rates of water evaporation-condensation. Heat flux at the wall was calculated for all regimes using a single semi-mechanistic model. Therefore, evolution of boiling regimes at every position on the wall surface was automatically determined. Predictions were validated using laboratory results, namely: a) Videorecording the upward motion of the wetting front along the workpiece wall surface, and b) cooling curves obtained with embedded thermocouples in the steel probe. Wall heat flux calculations were used to determine the importance of the simultaneous presence of all three boiling regimes on the heat flux distribution. It was found that this simultaneous presence leads to high heat flux variations that should be avoided in production lines.

Weather has significant impact on growth and plants development. It is important to analyze the influence of changing climate conditions on expression of plants agronomical characters. Two flax varieties were grown from 1987 to 2018 in the North-West of Russia. Whether conditions and their influence on flax agronomic characters were analyzed using variance and correlations analyses. Significant influence of year conditions on the manifestation of all evaluated characters was revealed. Starting from June high temperatures accelerate the development of plants at all stages. Prolongation of germination - flowering period is the most important for fiber productivity improvement. Oppositely, for formation of high quality fiber fast ripening in hot weather after flowering is preferable. Such data give possibility to predict the amount and quality of yield. Usage of weather conditions data also permits to compare results obtained in different years. Suggested method of year’s meteorological conditions classification can be used in other genebanks for systematization and analyses of crops field evaluation results. Correlation analyses reviled 3 correlated pleiades: (1) pleiade of productivity, (2) pleiade of fiber quality and yield, (3) pleiade of the growing season phases duration, the sums of active temperatures and precipitation during each period. Great influence of growing conditions on economically valuable traits indicates the necessity of searching for genotypes with stable characters manifestation for breeding new varieties, which will give stable yield and fiber of good quality.

In this communication, we present an innovative approach leveraging advanced Machine Learning (ML) and Artificial Intelligence (AI) techniques, specifically the Non-Negative Matrix Factorization (NMF) method, to analyze downward and upward light spectra collected by Hyperspectral Ocean Color Radiometer (HyperOCR, HOCR) sensors in the water column. Our work focuses on the development of a robust and efficient tool for unraveling the structure and activities of natural microbial assemblages in the ocean. By applying the NMF method to HyperOCR data, we successfully extracted five spectral signatures, representing unique patterns in the data. These signatures were instrumental in predicting the abundances of various microbial components, including bacteria, heterotrophic nanoflagellates, and picoeukaryotes, showcasing the potential of ML and AI in advancing oceanographic studies. To validate the methods, the study area included a shallow coastal area under the influence of freshwater inflow and an open offshore area with a depth of 100 m. The study sites in coastal and offshore waters (Kaštela Bay and Stončica Vis, respectively) had significantly different hydrographic and microbiological characteristics. Kaštela Bay had lower temperatures and salinity than the site on Vis. We have proved by application of different AI and ML methods with specific HOCR sensors prediction of the structure of the microbial community.

This paper proposes a new method for network screening on rural low-volume roads. These roads are important as they provide critical access to agricultural land and tourist attractions. Most low-volume roads belong to the lowest functional class (local rural roads) and thus are built to lower design standards. The conventional hot spot network screening techniques may not be appropriate for low-volume roads due to the sporadic nature of crashes occurring on these roads. Contrarily sophisticated network screening approaches require extensive roadway and traffic data that are often unavailable to local agencies for lack of resources, and/or lack of technical expertise. This research attempts to address these obstacles in low-volume roads network screening which aims to identify candidate sites for safety improvements. The research used an extensive low-volume road sample from the state of Oregon and the Empirical Bayes expected number of crashes in developing the proposed models for network screening. The proposed models do not require exact measurement of roadway geometric features as all geometric variables were classified into categories that are easy to compile by local agencies. Further, the method could be used with and without traffic data, without compromising the effectiveness of the network screening process.

In this study, a design of Morlet wavelet neural networks (MWNNs) is presented to solve the prediction differential model (PDM) using the global approximation capability of genetic algorithm (GA) and local quick interior-point algorithm scheme (IPAS), i.e., MWNN-GAIPAS. The famous PDM is known as a variant of functional differential system that works as an opposite of the historical delay differential models. A fitness function is optimized using the mean square error by applying the GA-IPAS for solving the PDM. Three PDM examples have been presented numerically to check the authenticity of the MWNN-GAIPAS. For the perfection of the designed MWNN-GAIPAS, the comparability of the obtained results and exact results is performed. Moreover, the neuron analysis is performed by taking the 3, 10 and 20 number of neurons. The statistical observations have been performed to authenticate the reliability of the MWNN-GAIPAS for solving the PDM.

The escalation of climate change and the increasing frequency of extreme weather events have amplified the importance of precise and timely lightning prediction. This predictive capability is pivotal for the preservation of life, protection of property, and maintenance of crucial infrastructure safety. Recently, the rapid advancement and successful application of data-driven deep learning across diverse sectors, particularly in computer vision and spatio-temporal data analysis, have opened up innovative avenues for enhancing both the accuracy and efficiency of lightning prediction. This article presents a comprehensive review of the broad spectrum of existing lightning prediction methodologies. Starting from traditional numerical forecasting techniques, we traverse the path to the most recent breakthroughs in deep learning research. We encapsulate these diverse methods, shedding light on their progression and summarizing their capabilities, while also predicting their future development trajectories. This exploration is designed to enhance our understanding of these methodologies, allowing us to better utilize their strengths, navigate their limitations, and potentially integrate these techniques to create novel and powerful lightning prediction tools. Through such endeavors, our aim is to bolster our preparedness against the growing unpredictability of our climate and ensure a proactive stance towards lightning prediction.

AlphaFold is a groundbreaking Deep Learning tool for protein structure prediction. It achieved remarkable accuracy in modeling the many 3D structures while taking as the input only the known amino acid sequence of proteins in question. Intriguingly though, in the early steps of each individual structure prediction procedure, AlphaFold is not respecting topological barriers that in real proteins result from the reciprocals impermeability of polypeptide chains. This study aims to investigate how this non-respecting of topological barriers affects AlphaFold predictions with respect to the topology of protein chains. We focus on such classes of proteins that during their natural folding form reproducibly the same knot type on their linear polypeptide chain as revealed by their crystallographic analysis. We use partially artificial test constructs in which the mutual non-permeability of polypeptide chains should not permit the formation of such knots during natural protein folding. We find that despite the formal impossibility that the protein folding process could produce such knots, AlphaFold predicts these proteins to be knotted. Our study underscores the necessity for cautious interpretation and further validation of topological features in protein structures predicted by AlphaFold.

This paper presents a new method of process parameters optimization, adequate for 3D printing of PLA (Polylactic Acid) components. The authors developed a new Hybrid Manufacturing Equipment (HME), suitable for producing complex parts made from a biodegradable thermoplastic polymer, for environmental sustainability. Our new HME equipment is producing PLA parts by both additive and subtractive techniques, with the aim of obtaining accurate PLA components with a good surface quality. A design of experiments has been applied for optimization purposes. The following manufacturing parameters were analyzed: rotation of the spindle, cutting depth, feed rate, layer thickness, nozzle speed, and surface roughness. Linear regression models and neural network models were developed to improve and predict the surface roughness of the manufactured parts. A new test part was designed and manufactured from PLA, to validate the new mathematical models, which can now be applied for producing complex parts made from polymer materials.

The Covid-19 pandemic and the subsequent implementation of lockdown measures have significantly impacted global electricity consumption, necessitating accurate energy consumption forecasts for optimal energy generation and distribution during a pandemic. In this study, we propose a new forecasting model called the Multivariate Multilayered LSTM with Covid-19 case injection ($\proposedModel$) for improved energy forecast during the next occurrence of a similar pandemic. We utilize data from commercial buildings in Melbourne, Australia during the Covid-19 pandemic to predict energy consumption and evaluate the model's performance against commonly used methods such as LSTM, Bi-LSTM, Linear Regression, Support Vector Machine and the previously published work of Multilayered LSTM (M-LSTM). The proposed forecasting model was analyzed using the following metrics of mean percent absolute error (MPAE), normalized root mean square error (NRMSE), and $R^2$ score values. The model $\proposedModel$ demonstrates superior performance, achieving the lowest MPAE values of 0.061, 0.093, and 0.158 for data sets from 3 different buildings, respectively. Our results highlight the improved precision and accuracy of the model, providing valuable information for energy management and decision-making during the challenges posed by the occurrence of a pandemic like Covid-19 in the future.

In light of the recent pandemic, several COVID-19 vaccines were developed, tested and approved in a very short time, a process that otherwise takes many years. Above all, these efforts have also unmistakably revealed the capacity limits and potential for improvement in vaccine production. This review aims to emphasize recent approaches for targeted rapid adaptation and production of vaccines from an interdisciplinary multifaceted perspective. Using literature research, stakeholder analysis and a value proposition canvas, we reviewed technological innovations on the pharmacological level, formulation, validation and resilient vaccine production to supply bottlenecks and logistic networks. We identified four main drivers to accelerate the vaccine product life cycle: computerized candidate screening, modular production, digitized quality management and a resilient business model with corresponding transparent supply chains. In summary, the results presented here can serve as a guide and implementation tool for flexible, scalable vaccine production to respond swiftly to pandemic situations in the future.

Financial markets require a great deal of decision making from the investors and market makers. One metric that can help ease the process of decision making is investment risk which can be measured in two parts; systematic risk and idiosyncratic risk. Clear understanding of the volatilities in each risk component can be a powerful signal in recognizing the right assets to maximize the investment returns. In this paper, we focus on the idiosyncratic volatility values and pre-calculate the idiosyncratic volatility values for 31,198 members of NYSE, Amex and Nasdaq markets for the trades occurring between January 1963 and December 2019. Utilizing a subset of dataset, limited to Nasdaq100 index, we consider the application of machine learning techniques in predicting the idiosyncratic volatility values using the raw trade data to explore a data extension option for the future market trade records that have not yet occurred. We offer a deep learning based regression model and compare it with traditional tree-based methods on a small subset of our per-calculated idiosyncratic volatility dataset. Our analytical results show that the performance of the deep learning techniques is much more robust in comparison to that of the traditional tree-based baselines.

In order to realize the performance degradation trend prediction accurately, a prediction method based on multi-domain features and temporal convolutional network (TCN) is proposed. Firstly, construct a high-dimensional feature set in the multi-domain of vibration signals, and use comprehensive evaluation indicators to preliminarily screen performance degradation indexes with good sensitivity and strong trend. Secondly, the kernel principal component analysis (KPCA) method is adopted to eliminate redundant information between multi-domain features, and construct a health index (HI) based on convolutional auto-encoder (CAE) network. Thirdly, a TCN-based performance degradation trend prediction model is constructed, and direct multi-step prediction is used to predict the performance degradation trend of the monitored object. On this basis, the validity of the proposed method is verified using the bearing public data, and it is successfully applied to performance degradation trend prediction of rolling contact fatigue specimen. The results show that the feature set can be reduced from 14 dimensions to 4 dimensions by using KPCA, while 98.33% of the information of the original feature set is retained. Furthermore, the method of constructing HI based on CAE network is effective. The change process of the HI constructed truly reflects the performance degradation process of the rolling contact fatigue specimen. Compared with the two commonly used HI construction methods, auto-encoding (AE) network and gaussian mixture model (GMM), this method has obvious advantages. At the same time, the prediction model based on TCN can accurately predict the performance degradation of the rolling contact fatigue specimen with the root mean square error 0.0146 and the mean absolute error 0.0105, which has better performance and higher prediction accuracy than the prediction model based on the long short-term memory (LSTM) network and the gated recurrent unit (GRU). This method has general significance and may be extended to the performance degradation prediction of other mechanical equipment/parts.

Ligand-based virtual screening (LBVS) is a promising approach for rapid and low-cost screening of potentially bioactive molecules in the early stage of drug discovery. Compared with traditional similarity-based machine learning methods, deep learning frameworks for LBVS can more effectively extract high-order molecule structure representations from molecular fingerprints or structures. However, the 3D conformation of a molecule largely influences its bioactivity and physical properties, and has rarely been considered in previous deep learning-based LBVS methods. Moreover, the relative bioactivity benchmark dataset is still lacking. To address these issues, we introduce a novel end-to-end deep learning architecture trained from molecular conformers for LBVS. We first extracted molecule conformers from multiple public molecular bioactivity data and consolidated them into a large-scale bioactivity benchmark dataset, which totally includes millions of endpoints and molecules corresponding to 954 targets. Then, we devised a deep learning-based LBVS called EquiVS to learn molecule representations from conformers for bioactivity prediction. Specifically, graph convolutional network (GCN) and equivariant graph neural network (EGNN) are sequentially stacked to learn high-order molecule-level and conformer-level representations, followed by attention-based deep multiple-instance learning (MIL) to aggregate these representations and then predict the potential bioactivity for the query molecule on a given target. We conducted various experiments to validate the data quality of our benchmark dataset, and confirmed EquiVS achieved better performance compared with 10 traditional machine learning or deep learning-based LBVS methods. Further ablation studies demonstrate the significant contribution of molecular conformation for bioactivity prediction, as well as the reasonability and non-redundancy of deep learning architecture in EquiVS. Finally, a model interpretation case study on CDK2 shows the potential of EquiVS in optimal conformer discovery. The overall study shows that our proposed benchmark dataset and EquiVS method have promising prospects in virtual screening applications.

Deep learning has been applied in many areas that have had a significant impact on applications that improves real-life challenges. The success of deep learning in a wide range of areas is due in part to the use of activation functions, which are particularly effective at solving non-linear problems. Activation functions are a key focus for researchers in artificial intelligence who aim to improve the performance of neural networks. This article provides a comprehensive explanation and comparison of different activation functions, with a focus on the arc tangent and its variations specifically. The paper presents experimental results that show that variations of the arc tangent using irrational numbers such as pi, the golden ratio, and Euler’s number, as well as a self-arctan function, produce promising results. Since we experimented with promising activation functions on two different problems, and datasets, we reached a result that different irrationals work well for different problems. In other words, arctan ϕ gives the best results mostly for multiclass classification and arctan e gives the best results for time series prediction problems. The paper focuses on a multiclass classification problem applied to the Reuters Newswire dataset and a time-series prediction problem on Türkiye energy trade value to show the impacts of activation functions.

With the growing of university chemistry experiment projects, scientific research personnel, specialized equipment, laboratory accident is increasing yearly. And accident data lacks a safety platform to store related information and cannot be guaranteed for efficient conditional sharing. To solve these problems, we designed a laboratory accident system to store, share related data and predict risk level. In this paper, we manually collected chemistry laboratory accidents by python software and class assignments, then analyses risk factor variables using Spsspro, finally established a prediction model using Stata. We intended to register laboratory related data into proposed chemistry accident system based on data ownership safety architecture. The chemistry accident system can break data barriers using confirmation and authorization key technology to trace non-tampered data source in real time when emergency accident happens. Meanwhile, our proposed system can use our designed accident risk model to predict risk level of any experiment project. It can also recommend appropriate safety education models.

Earliest critical context of the pandemic, preceding the first real epidemiological wave of contagion in Bulgaria, was examined in a socio-affective perspective. A retrospective and agnostic analytical approach was adopted. Our goal was to identify traits and trends that explain public health support (PHS) of Bulgarians during the first two months of the declared state of emergency. We investigated a set of variables with a unified method within an international scientific network, named International Collaboration on Social & Moral Psychology of COVID-19 (ICSMP) in April and May 2020. Conspiracy Theories beliefs were a significant predictor of lower PHS. Psychological Well-being was significantly associated with Physical Contact and Anti-Corona Policy Support. Physical Contact was significantly predicted by less Conspiracy Theories beliefs, higher Collective Narcissism, Open-mindedness, higher Trait Self-Control, Moral Identity, Risk Perception, and Psychological Well-Being. Physical Hygiene compliance was predicted by less Conspiracy Theories beliefs, Collective Narcissism, Morality-as-Cooperation, Moral Identity, and Psychological Well-Being. Results revealed two polar trends of support and non-support of public health policies. The contribution of this study is in providing evidence for affective polarization and phenomenology of (non)precarity during the outbreak of the pandemic.

This work considers the task of representation learning on the attributed relational graph (ARG). Both the nodes and edges in an ARG are associated with attributes/features allowing ARGs to encode rich structural information widely observed in real applications. Existing graph neural networks offer limited ability to capture complex interactions within local structural contexts, which hinders them from taking advantage of the expression power of ARGs. We propose Motif Convolution Module (MCM), a new motif-based graph representation learning technique to better utilize local structural information. The ability to handle continuous edge and node features is one of MCM’s advantages over existing motif-based models. MCM builds a motif vocabulary in an unsupervised way and deploys a novel motif convolution operation to extract the local structural context of individual nodes, which is then used to learn higher-level node representations via multilayer perceptron and/or message passing in graph neural networks. When compared with other graph learning approaches to classifying synthetic graphs, our approach is substantially better in capturing structural context. We also demonstrate the performance and explainability advantages of our approach by applying it to several molecular benchmarks.

Every month teachers face the dilemma of what exercises should their students practice, and what their consequences are on long-term learning. Since teachers prefer to pose their own exercises, this generates a large number of questions, each one attempted by a small number of students. Thus, we couldn’t use models based on big data such as deep learning. Instead, we developed a simple to understand state-space model that predicts end-of-year national test scores. We used 2,386 online fourth-grade mathematic questions designed by teachers and each attempted by some of the 500 students in 24 low socioeconomic schools. We found that the state-space model predictions improved month-by-month and that in most months it outperformed linear regression models. Moreover, the state-space estimator provides for each month a direct mechanism to simulate different practice strategies and compute their impact on the end-of-year standardized national test. We built iso-impact curves based on two critical variables: the number of questions solved correctly in the first attempt and the total number of exercises attempted. This allows the teacher to visualize the trade-off between asking students to do exercises more carefully or doing more exercises. To the best of our knowledge, this model is the first of its kind in education. It is a novel tool that supports teachers drive whole classes to achieve long-term learning targets.

Early stroke diagnosis remains a big challenge in healthcare partly due to the lack of reliable diagnostic blood biomarkers, which in turn leads to increased rates of mortality and disability. Current screening methods are optimised to identify patients with a high risk of cardio-vascular disease, especially among the elderly. However, in young adults and children, these methods suffer low sensitivity and specificity and contribute to further delays in their triage and diagnosis. Accordingly, there is an urgent need to develop reliable blood biomarkers for triaging patients suspected of stroke in all age groups, especially children and young adults. This review explores some of the existing blood biomarkers, as single biomarkers, or biomarker panels, and examine their sensitivity and specificity for predicting stroke. A review was performed on PubMed and Web of Science for journal articles published in English during the period 2001 to 2021 which contained information regarding biomarkers of stroke. In this review article, we provide comparative information on the availability, clinical usefulness, and time-window periods of eight single blood biomarkers and six biomarker panels that have been used for predicting stroke in emergency situations. The outcomes of this review can be used in future research for developing more effective stroke biomarkers.

Internet of Things (IoT) technologies can greatly benefit from machine learning techniques and Artificial Neural Networks for data mining and vice versa. In the agricultural field, this convergence could result in the development of smart farming systems suitable for use as decision support systems by peasant farmers. This work presents the design of a smart farming system for crop production, which is based on low-cost IoT sensors and popular data storage services and data analytics services on the Cloud. Moreover, a new data mining method exploiting climate data along with crop production data is proposed for the prediction of production volume from heterogeneous data sources. This method was initially validated using traditional machine learning techniques and open historical data of the northeast region of the state of Puebla, Mexico, which were collected from data sources from the National Water Commission and the Agri-food Information Service of the Mexican Government.

Software reliability is an important characteristic for ensuring the qualities of software products. Predicting the potential number of bugs from the beginning of a development project allows practitioners to make the appropriate decisions regarding testing activities. In the initial development phases, applying traditional software reliability growth models (SRGMs) with limited past data does not always provide reliable prediction result for decision making. To overcome this, herein we propose a new software reliability modeling method called deep cross-project software reliability growth model (DC-SRGM). DC-SRGM is a cross-project prediction method that uses features of previous projects’ data through project similarity. Specifically, the proposed method applies cluster-based project selection for training data source and modeling by a deep learning method. Experiments involving 15 real datasets from a company and 11 open source software datasets show that DC-SRGM can more precisely describe the reliability of ongoing development projects than existing traditional SRGMs and the LSTM model.

Photovoltaic (PV) generation is potentially uncertain. Probabilistic PV generation forecasting methods have been proposed with prediction intervals (PIs). However, several studies have dealt with geographically distributed PVs in a certain area. In this study, a two-step probabilistic forecast scheme is proposed for geographically distributed PV generation forecasting. Each step of the proposed scheme adopts ensemble forecasting based on three different machine-learning methods. In this case study, the proposed scheme was compared with conventional non-multistep forecasting. The proposed scheme improved the reliability of the PIs and deterministic PV forecasting results through 30 days of continuous operation with real data in Japan.

The incidence of Type 1 Diabetes (T1D) in the Arab world, particularly, oil and gas rich Gulf Cooperative Council (GCC) countries has more than doubled in the last twenty years. Therefore, there is a dire need for careful systematic familial cohort studies, especially in high-risk populations. Several immunogenetic factors affect the pathogenesis of the disease. Genes in the human leukocyte antigen (HLA) account for the major genetic susceptibility to the disease. The triggering agents initiate disease onset by destruction of pancreatic β-cells. The autoantibodies against glutamic acid decarboxylase (GADA), insulinoma antigen-2 (IA-2A), insulin (IAA), and zinc transporter-8 (ZnT-8A) comprise the most reliable biomarkers for T1D in both children and adults. Although three of the GCC countries, namely Kuwait, Saudi Arabia and Qatar are among the top 10 countries with high incidence rate of T1D, no proper diagnostic and prediction tools were applied in the region. Understanding the disease sequelae in a homogenous gene pool with high consanguinity in the GCC could help solve the challenges in understanding pathogenesis, as well as hasten the prevention of T1D. Arab states must incorporate T1D predictive and intervention policies on a war-footing basis to minimize the burden of this serious disease.

The growth of regularly generated data from many financial activities has significant implications for every corner of financial modeling. This study has investigated the utilization of these continuous growing data by a means of an automated process. The automated process can be developed by using Machine learning based techniques that analyze the data and gain experience from the underlying data. Different important domains of financial fields such as Credit card fraud detection, bankruptcy detection, loan default prediction, investment prediction, marketing and many other financial models can be modeled by implementing machine learning models. Among several machine learning based techniques, the use of parametric and non-parametric based methods are approached by this research. Two parametric models namely Logistic Regression, Gaussian Naive Bayes models and two non-parametric methods such as Random Forest, Decision Tree are implemented in this paper. All the mentioned models are developed and implemented in the field of Credit card fraud detection, bankruptcy detection, loan default prediction. In each of the aforementioned cases, the comparative study among the classification techniques is drawn and the best model is identified. The performance of each classifier on each considered domain is evaluated by various performance metrics such as accuracy, recall, precision, F1-score and mean squared error. In the credit card fraud detection model the decision tree classifier performs the best with an accuracy of 99.1% and, in the loan default prediction and bankruptcy detection model, the random forest classifier gives the best accuracy of 97% and 96.84% respectively.

Highly nonlinear characteristics of lithium-ion batteries (LIBs) are significantly influenced by the external and internal temperature of the LIB cell. Moreover, cell temperature beyond the manufacturer’s specified safe operating limit could lead to thermal runaway and even fire hazards and safety concerns to operating personnel. Therefore, accurate information of cell internal and surface temperature of LIB is highly crucial for effective thermal management and proper operation of a battery management system (BMS). Accurate temperature information is also essential to BMS for the accurate estimation of various important states of LIB such as state of charge, state of health and so on. High capacity LIB pack, used in electric vehicles and grid-tied stationary energy storage system essentially consists of thousands of individual LIB cells. Therefore, installing a physical sensor at each cell especially at the cell core is not practically feasible from the solution cost, space and weight point of view. A solution is to develop a suitable estimation strategy which led scholars to propose different temperature estimation schemes aiming to establish a balance among accuracy, adaptability, modelling complexity and computational cost. This article presented an exhaustive review of these estimation strategies covering recent developments, current issues, major challenges, and future research recommendations. The prime intention is to provide a detailed guideline to the researchers and industries towards developing a highly accurate, intelligent, adaptive, easy to implement and compute efficient online temperature estimation strategy applicable to health-conscious fast charging and smart onboard BMS.

The aim of this study was to develop a basic model to predict enteric methane emission from dairy cows and to update operational calculations for the national inventory in Norway. Basic models were developed using a database with 63 treatment means from 19 studies. The database included records for enteric CH4 production (MJ/day), dry matter intake (DMI), and dietary nutrient composition. The basic models were evaluated against an external database (n=36, from ten studies) along with other extant models. When evaluated by low root mean square prediction errors and high concordance correlation coefficients, the developed basic models that included DMI, dietary concentrations of fatty acids and neutral detergent fiber performed slightly better in predicting CH4 emissions than extant models. In order to propose country-specific values for the CH4 conversion factor Ym (% of gross energy intake partitioned into CH4) and thus to carry out the national inventory for Norway, the existing operational model was updated for the prediction of Ym over a wide range of feeding situations using energy corrected milk and dietary concentrate share as predictor variables. Input values of Ym were updated based on the results from the basic models. The predicted Ym ranged from 6.22 to 6.72%. In conclusion, the prediction of CH4 production from dairy cows was improved with the help of newly published data, which enabled an update of the operational model for calculating the national inventory of CH4 in Norway.

Effectively avoiding gas accident is vital to the security of mineral manufacture, and the coal mine gas accident is often caused by gas concentration overrun. The prediction accuracy of gas emission quantity in coal mine is the key to solve this problem. To maintain concentration of gas in a secure range，grey theory and neural network model increasingly diffusely used in forecasting gas emission quantity in coal mine critically. Nevertheless, the limitation of the grey neural network model is that researchers merely bonded the conventional neural network and grey theory. To enhance accuracy of prediction, a modified grey GM(1,1) and RBF neural network model is proposed combined amended grey GM(1,1) model and RBF neural network model. Then the proposed model was put into simulation experiment which is built based on Matlab software. Ultimately, conclusion of the simulation experiment verified that the modified grey GM(1,1) and RBF neural network model not only boosts the precision of prediction, but also restricts relative error in a minimum range. This showed that the modified grey GM(1,1) and RBF neural network model achieves effectiveness in precision of prediction much better than grey GM(1,1) model and RBF neural network model.

The food distribution process is responsible for significant quality loss in perishable products. However, preserving quality is costly and consumes a tremendous amount of energy. To tackle the challenge of minimizing transportation costs and CO2 emissions while also maximizing product freshness, a novel multi-objective model is proposed. The model integrates a vehicle routing problem with temperature, shelf life, and energy consumption prediction models, thereby enhancing its accuracy. Non-dominated sorting genetic algorithm II is adapted to solve the proposed model for the set of Solomon test data. The conflicting nature of these objectives and the sensitivity of the model to shelf life and shipping container temperature settings are analyzed. The results show that optimizing freshness objective degrade the cost and the emission objectives, and the distribution of perishable foods are sensible to the shelf life of the perishable foods and temperature settings inside the container.

The most common index for representing structural condition of the pavement is the structural number. The current procedure for determining structural numbers involves utilizing falling weight deflectometer and ground-penetrating radar tests, recording pavement surface deflections, and analyzing recorded deflections by back-calculation manners. This procedure has two drawbacks: 1. falling weight deflectometer and ground-penetrating radar are expensive tests, 2. back-calculation ways has some inherent shortcomings compared to exact methods as they adopt a trial and error approach. In this study, three machine learning methods entitled Gaussian process regression, m5p model tree, and random forest used for the prediction of structural numbers in flexible pavements. Dataset of this paper is related to 759 flexible pavement sections at Semnan and Khuzestan provinces in Iran and includes “structural number” as output and “surface deflections and surface temperature” as inputs. The accuracy of results was examined based on three criteria of R, MAE, and RMSE. Among the methods employed in this paper, random forest is the most accurate as it yields the best values for above criteria (R=0.841, MAE=0.592, and RMSE=0.760). The proposed method does not require to use ground penetrating radar test, which in turn reduce costs and work difficulty. Using machine learning methods instead of back-calculation improves the calculation process quality and accuracy.

Predictive simulation of concurrent debris flow using only pre-disaster information has proven to be difficult as a result of problems in predicting the location of debris-flow initiation (i.e., slope failure). However, because catchment topography has concave characteristics, with all channels in a catchment joining each other as they flow downstream, it is possible to predict damage to downstream area using relatively inaccurate initiation points. Based on this, this paper presents methodologies employing debris-flow initiation points generated randomly using statistical slope failure prediction. A many-case simulation across numerous initiation points was performed to quantify the effect of slope-failure location in terms of deviations in the predicted water level and terrain deformation. It was found that the relative standard deviation diminished as the points approached the downstream area, indicating a location-based predictability effect.

There are guidelines on lactation following maternal analgo-sedative exposure, but these do not consider the effect of maternal fasting, nor fluid abstention on human milk macronutrient composition. We therefore performed a structured search (PubMed) on ‘human milk composition’ and screened title, abstract and full paper on ‘fasting’ or ‘abstention’ and ‘macronutrient composition’ (lactose, protein, fat, solids, triglycerides, cholesterol). This resulted in 6 papers and one abstract related to religious fasting (n=129 women) and observational studies in lactating women (n=23, healthy volunteers, fasting). These data reflect two different ‘fasting’ patterns: an acute (18-25h) model in 71 (healthy volunteers, Yom Kippur/Ninth of Av) women and a chronic fasting (Ramadan) model in 81 women. Changes were most related to electrolytes and were moderate, with almost no changes in macronutrients during acute fasting. We therefor conclude that neither short term fasting nor fluid abstention (18-25h) affect human milk macronutrient composition, so that women can be reassured when this topic were raised during consulting. Besides the nutritional relevance, this also matters as clinical research samples – especially to estimate analgo-sedative exposure by lactation - are commonly collected after maternal procedural sedation, associated with maternal fasting and physiology-based pharmacokinetic (PBPK) models assume stable human milk composition.

Single nucleotide polymorphisms (SNP) are associated with diseases and drug response variabilities in humans. Elucidating the damaging and disease-associated SNPs using wet-laboratory approaches can be challenging and resource-demanding due to the large number of SNPs in the human genome. Due to the growth in the field of computational biology and bioinformatics, algorithms have been developed to help screen and filter out the most deleterious SNPs that are worth considering for wet-laboratory studies. Here we review the existing in-silico based methods used to predict and characterize the effects of SNPs on protein structure and function. This cutting-edge approach will facilitate the search for novel therapeutics, help understand the etiology of diseases and fast-track the personalized medicine agenda.

Background: Accurate prediction of patients’ response to therapy is clinically indispensable, howbeit challenging. With increased understanding of the human genome and malignancies, there is the renaissance of in silico pharmacogenomics with renewed interest in drug response predictability based on gene-drug interaction. Objective: Evidence-based transcript-proteome profiling is essential for synthesizing clinically applicable algorithms for predicting response to anticancer therapy, including immune checkpoint blockade (ICBT); thus, saving physicians’ time, reducing polypharmacy, and curtailing unnecessary treatment expense. In this study, we tested and validated the hypothesis that a selected proteomic signature in ICBT-naïve patients is sufficient for the prediction of response to ICBT. Methods: Using a multimodal approach consisting of computational pharmacogenomics, transcript-proteome analytics, mathematical modeling, and machine learning systems; we delineated therapy-sensitivity and stratified patients into graduated response groups based on their proteomic profile. Protein expression levels in our cohort tissue specimens were evaluated based on T cell- and non-T cell- inflamed phenotypes by immunohistochemistry. Results: We established β-catenin, PDL1, CD3 and CD8 expression-based ICBT response model. Statistical regression models validated the predictive association between our predefined algorithms and therapeutic outcome. Interestingly, our 4-gene prediction classifier was constitutively independent of tumor tissue origin, correctly stratified patients into high-, low-, and non- responders pre-treatment, with high prediction accuracy, and exhibited good association with patients’ performance status and prognosis (p < 0.01). Conclusion: Our findings demonstrate the possibility of accurate proteomics based ICBT response prediction and provide a putative basis for drug response prediction based on selective proteome profile in untreated cancer patients.

The accuracy of sales prediction models based on the big data of online word-of-mouth (eWOM) is still not satisfied. We argue that eWOM contains heat and sentiments of different product dimensions, which can improve the accuracy of these models. In this paper, we propose a dynamic topic analysis (DTA) framework in order to extract heat and sentiments of product dimensions from the big data of eWOM. Finally, we propose an autoregressive-heat-sentiment (ARHS) model, which integrates heat and sentiments of dimensions into the baseline predictive model. The empirical study in movie industry confirms that heat and sentiments of dimensions can improve the accuracy of sales prediction model. ARHS model is better for movie box-office revenue prediction than other models.

Over the past two decades, persistent occurrences of harmful algal blooms (HAB; Karenia brevis) have been reported in Charlotte County, southwestern Florida. We developed data-driven models that rely on spatiotemporal remote sensing and field data to identify factors controlling HAB propagation, provide a same-day distribution (nowcasting), and forecast their occurrences up to three days in advance. We constructed multivariate regression models using historical HAB occurrences (213 events reported from January 2010 to October 2017) compiled by the Florida Fish and Wildlife Conservation Commission and validated the models against a subset (20%) of the reported historical events. The models were designed to specifically capture the onset of the HABs instead of those that developed days earlier and continued thereafter. A prototype of an early warning system was developed through a threefold exercise. The first step involved the automatic downloading and processing of daily Moderate Resolution Imaging Spectroradiometer (MODIS) Aqua products using SeaDAS ocean color processing software to extract temporal and spatial variations of remote sensing-based variables over the study area. The second step involved the development of a multivariate regression model for same-day mapping of HABs and similar subsequent models for forecasting HAB occurrences one, two, and three days in advance. Eleven remote sensing variables and two non-remote sensing variables were used as inputs for the generated models. In the third and final step, model outputs (same-day and forecasted distribution of HABs) were posted automatically on a web-based GIS (http://www.esrs.wmich.edu/webmap/bloom/). Our findings include the following: (1) the variables most indicative of the timing of bloom propagation are bathymetry, euphotic depth, wind direction, SST, chlorophyll-a [OC3M] and distance from the river mouth, and (2) the model predictions were 90% successful for same-day mapping and 65%, 72% and 71% for the one-, two- and three-day advance predictions, respectively. The adopted methodologies are reliable, dependent on readily available remote sensing data sets, and cost-effective and thus could potentially be used to map and forecast algal bloom occurrences in data-scarce regions.

In this paper, we propose an adaptive duty-cycled hybrid X-MAC (ADX-MAC) protocol for energy-efficient forest fire prediction. The X-MAC protocol acquires the additional environmental status collected by each forest fire monitoring sensor for a certain period. And, based on these values, the length of sleep interval of duty-cycle is changed to efficiently calculate the risk of occurrence of forest fire according to the mountain environment. The performance of the proposed ADX-MAC protocol was verified through experiments the proposed ADX-MAC protocol improves throughput by 19% and was more energy-efficient by 24% compared to X-MAC protocol. As the probability of forest fires increases, the length of the duty cycle is shortened, confirming that the forest fires are detected at a faster cycle.

Vibration measurement serves as the basis for various engineering practices such as natural frequency or resonant frequency estimation. As image acquisition devices become cheaper and faster, vibration measurement and frequency estimation through image sequence analysis continue to receive increasing attention. In the conventional photogrammetry and optical methods of frequency measurement, vibration signals are first extracted before implementing the vibration frequency analysis algorithm. In this work, we demonstrated that frequency prediction can be achieved using a single feed-forward convolutional neural network. The proposed method is verified using a vibration signal generator and excitation system, and the result obtained was compared with that of an industrial contact vibrometer in a real application. Our experimental results demonstrate that the proposed method can achieve acceptable prediction accuracy even in unfavorable field conditions.

1) Landsat operational land imager (OLI) data and consequent laboratory measurements were used to predict Chlorophyll-a (Chl-a) concentration and the trophic states for an inland lake within the East Kolkata Wetland, India; 2) The most suitable band ratio was identified by performing Pearson correlation analysis between Chl-a concentrations and possible OLI band and band ratios from the study points; 3) The results showed highest correlation coefficient from the band ratio OLI5/OLI4 with an R value of 0.85. The prediction model was then developed by applying regression analysis between the band ratio OLI5/OLI4 and Chl-a concentration of the study points. The reflectance ratios of the validation points were given as input on the prediction model and the model output was considered as predicted Chl-a values of the validation points to check the efficiency of the prediction model. The regression model between laboratory-derived Chl-a value and model-fitted Chl-a value of the validation points revealed a high correlation with an R² value of 0.78. Trophic State Index (TSI) of the lake was also calculated from laboratory-derived Chl-a value and model-fitted Chl-a value of the validation points. The study presented a high correlation of TSI determined from predicted data with TSI from laboratory reference data (R = 0.88). The TSI values of the lake ranged from 65 to 75 which indicate that the lake is appeared to be eutrophic to hypereutrophic conditions. 4) This empirical study showed that Landsat 8 OLI imagery can be effectively applied to estimate Chl-a levels and trophic states for inland lakes.

Time-series analysis is a widely used technique across various fields and industries, as it helps in understanding, predicting, and forecasting the behavior of data points over time. These fields include but are not limited to finance, economics, healthcare, transportation, etc. In the case of this paper, we have focused on finance. Predicting future values of financial time series offers several benefits. Accurate forecasts can help investors make better decisions about their investments. To predict future values, deep learning algorithms are commonly used since it is an effective method with complex data. In this study, we conduct a study that investigates the use of different data pre-processing techniques on deep learning algorithms in predicting the time series values. To conduct this experimental study, we utilize an open source software, which using long short-term memory technique as the representative deep learning technique, published in github software code repository platform. With this study, we investigate the effects of autoencoder and discrete wavelet transform data pre-processing techniques in time-series prediction. We discuss the details of the experimental study and report our results. The results show that time series prediction (using backtesting methodology) without any data pre-processing leads to 12.6% for mean absolute percentage error. The results also show that, time series prediction with the data preprocessing techniques (Wavelet Transform and Stacked Autoencoder) lead to 3.4%

While the simple model of the total atmospheric carbon sink effect as a linear function of concentration has provided excellent prediction results, several problems remained to be investigated and solved. The most obvious open issue is the correct treatment of land use change emssions. It turns out that the model improves by mostly neglecting them after 1959. This effectively implies that land use change emissions have been constant and small since then. The key investigation starts with the observation, that the total carbon sink has a short term component which be explained by temperature changes commonly known as El Nin˜o. The apparent paradox is analysed and explained, why contrary to the short term changes no temperature caused trend can be detected in the model, despite the fact that several contributing processes exhibit temperature dependency. The result of this analysis leads to the model extension, where the total effect of sinks and natural emissions are a linear function of concentration and temperature. This model not only explains current measurements but also paleo climate from ice-core time series.

Software stands as one of the most rapidly evolving technologies in the present era, characterized by its swift expansion in both scale and complexity which leads to challenges in quality assurance. Software Defect Prediction (SDP) emerges as a methodology crafted to anticipate undiscovered defects, leveraging known defect data from existing codes. This methodology serves to facilitate software quality management, thereby ensuring overall product quality. Machine Learning (ML) and Deep Learning (DL) methodologies exhibit superior accuracy and adaptability compared to traditional statistical approaches catalyzing active researches in this domain. However, it makes us hard to generalize not only because of the disparity between open-source project and commercial project but also the difference on each industrial sectors. Consequently, further research utilizing datasets sourced from diverse real-world sectors becomes imperative to bolster the applicability of these findings. In this study, we utilized embedded software for telecommunication systems of SAMSUNG ELECTRONICS, supplemented by the introduction of nine novel features to train the model, and subsequent analysis of results ensued. Experimental outcomes revealed that the F-measurement metric has been enhanced from 0.58 to 0.63 upon integration of the new features, thereby signifying a performance augmentation of 8.62%. This case study is anticipated to contribute to bolster the application of SDP methodologies within analogous industrial sectors.

This article describes the POTENTIALS project, which aimed to develop business models for the reuse of former industrial and mining sites in different regions. The project focused on the creation of eco-industrial parks as a result to enable sustainable energy production and reduce waste and pollution. A key aspect was the Territorial Impact Assessment (TIA), a new and complex policy assessment tool. Therefore, the TEQUILA (Territorial Efficiency Quality and Identity Layer Assessment) approach is used to describe the TIA and emphasizes its application in assessing the impact of EU policies and projects on territorial cohesion. It underlines the need for a differentiated understanding of the regional characteristics and potential impacts of policies; and stresses the importance of regionalized impact models for the assessment. Furthermore, the process and results of applying the TEQUILA methodology to assess the territorial impact of different scenarios of business models within the POTENTIALS project is given.

Website defacement is an illegal electronic act of changing a website. In this paper, robust machine learning classifiers’ capabilities were exploited to select the best input feature set for evaluating a website’s defacement risk. Zone-H, a private organization, offered us a defacement mining dataset. A sample of 93644 datapoints was concisely pre-processed and used for modelling purposes. Considering multidimensional features as input, reason and hackmode variables were chosen as outputs. Massive machine learning models were examined; however, decision tree (DT), k-nearest neighbour (k-NN), and random forest (RF) were the most powerful algorithms used to predict the target model. The input variables 'domain', 'system', 'web_server','redefacement', 'type', 'def_grade', and 'reason/hackmode' were tested and used to shape the final model. Using the cross-validation (CV) technique, the model’s key performance factors were calculated and reported. After calculating the average scores for the hyperbolic metrics (i.e., max-depth, min-sample-leaf, weight, max-features, and CV), both targets were evaluated, and the learning algorithms were ranked as RF, DT, and k-NN. The reason and hackmode variables were thoroughly analysed. The average score accuracies for the reason and hackmode targets were 0.85 and 0.585, respectively. The results showed a significant development in terms of modelling and optimizing website defacement risk. The study also successfully addresses the main cybersecurity concerns, in particular website defacement.

The assessment and prediction of drought risk under future climate change and land use land cover (LULC) scenarios is critically important for drought prevention and mitigation, as it enables a clearer understanding of potential shifts in drought patterns. The primary aim of this study is to evaluate sub-seasonal and seasonal meteorological and hydrological drought hazards across the Yellow River Basin (YRB) under projected future climate conditions and LULC patterns. The BCC-CSM1-1 climate model projections from the NASA Earth Exchange Global Daily Downscaled Projections (NEX-GDDP) dataset are utilized to represent future climate for 2025-2060 under RCP 4.5 and 8.5 scenarios. The CA-Markov model is employed to predict future LULC distributions. Meteorological and hydrological drought risks across different YRB zones are evaluated through a copula-based risk assessment approach, based on the joint probability distribution of drought duration and severity. The results indicate that sub-seasonal meteorological and hydrological droughts will likely be the primary concern moving forward. Specifically, the upper YRB (zones A, B, C) exhibits greater vulnerability to sub-seasonal meteorological drought, while the Loess Plateau (zones C, E) shows higher susceptibility to sub-seasonal hydrological drought. Moreover, zone F in the downstream region may experience increased seasonal hydrological drought risk due to projected urban expansion in the middle and lower portions of the YRB.

The problem of low soil fertility and limited research in agricultural data driven tools, may lead to low crop productivity which makes it imperative to research in applications of high throughput computational algorithms such as of machine learning (ML) for effective soil analysis and fertility status prediction in order to assist in optimal soil fertility management decision-making activities. However, difficulties in the choice of the key soil properties parameters for use in reliable soil nutrients analysis and fertility prediction. Also, individual ML algorithms setbacks and modelling expert implementation procedures subjectivity, may lead to exploitation of worst fertility level targets and soil fertility status targets classification models performance reported variations. This paper surveys state-of-affair in ML for agricultural soil nutrients analysis and fertility status prediction. Prominent soil properties and widely used classical modelling algorithms and procedures are identified. Empirically exploited fertility status target classes are scrutinized, and reported soil fertility prediction model performances are depicted. The three pass method, with mixed method of qualitative content analysis and qualitative simple descriptive statistics were used in this survey. Observably, the frequently used soil nutrients and chemical properties were organic carbon, phosphorus, potassium, and potential Hydrogen, followed by iron, manganese, copper and zinc. Predominant algorithms included Random Forest, and Naïve Bayes, followed by Support Vector Machine. Model performances varied, with highest accuracy 98.93% and 98.15% achieved by ensemble methods, and the least being 60%. Interdisciplinary ML related researchers may consider using ensemble methods to develop high performance soil fertility status prediction models.

. Identifying students who might have difficulty in their course of studies ahead of time is crucial. There can be many reasons for performance issues, such as personality, family, social, and/or economic. We advocate that educational systems should use machine learning to predict students’ performance based on performance factors. This would allow educational professionals and institutions to put in place a preventive plan to help students towards achievements of their educational goals and success. In this chapter, we propose a student performance prediction method and evaluate its performance. We provide a taxonomy of performance factors that help to gauge students performance from different perspectives and give insights on the categories and features that have more significant impact on students’ performance. The results of this work can be used by education institutions to put in place a student-centric approach to tackle performance issues before they create long-term effects on student’s life. In addition, it will help education policymakers to introduce a tailored approach for the population in specific areas.

Environmental monitoring systems play a crucial role in assessing environmental quality, detecting limits exceedances, and predicting potential ecological episodes. These systems rely on the measurement of various variables at specific locations and time intervals over an extended period. The concept of environmental monitoring encompasses the assessment of health and safety issues for public and environmental health purposes. Pollution of the atmosphere and water, climate change, and natural disasters are among the consequences of continuous industrial and municipal development and human interference in natural ecosystems. To address these challenges and to protect human lives and the environment, with a special concern on mitigating the ecological effects of industrial development, advanced technical solutions, including the technologies associated with artificial intelligence (artificial neural networks ANNs, machine learning ML) have been developed. These technologies offer powerful tools for analysing the vast amount of data collected by monitoring systems and extracting valuable insights. By applying ANNs and machine learning algorithms, environmental monitoring systems can effectively process and interpret the measured variables to assess environmental quality. Despite challenges and limitations, such as data quality and interpretability of AI models, ongoing research and interdisciplinary collaboration are paving the way for the successful implementation of AI in environmental monitoring, ultimately supporting informed decision-making and sustainable resource management.While several review papers have explored the theory of artificial intelligence (AI), here I aim to review the application of ANNs and ML, in environmental aspects, specifically in automotive and industrial emissions toxicity measurements, as well as atmospheric pollution prevention. By examining the potential of AI in these domains, the paper contributes to understanding the role of advanced technologies in environmental monitoring and protection.

Oral and parenteral delivery of first-line anticonvulsant Valproic cid (VA) are associated with serious adverse effects, high hepatic metabolism, high clearance, and low bioavailability in brain. GastroPlus program was used to predict in vivo performance of immediate (IR) and sustained release (SR) products in human. HSPiP software predicted excipients with maximum possible miscibility of the drug. Based on GastroPlus and HSPiP program, various excipients were screened for experimental solubility study and prepared cationic nanoemulsions and respective gels for nasal to brain delivery. These were characterised for size, size distribution, polydispersity index, zeta potential, morphology, pH, % transmittance, drug content, and viscosity. In vitro drug release, ex vivo permeation profile (goat nasal mucosa), and penetration studies were conducted. Result showed that in-vivo oral drug dissolution and absorption were predicted as 98.6 mg and 18.8 mg, respectively from both tablets (IR and SR) at 8 h using GastroPlus. The drug access to the portal vein was relatively predicted high in IR (115 mg) as compared to SR (82.6 mg). Plasma drug concentration-time profile predicted was in good agreement with published reports. The program predicted duodenum and jejunum as the prime site of drug absorption and no effect of nanonization on Tmax for sustained release formulation. Hansen parameters suggested suitable selection of excipients. The program recommended for nasal to brain delivery of the drug using cationic mucoadhesive product. The optimized stable CVE6 was associated with optimal size (113 nm), low PDI (0.26), high zeta potential (+34.7 mV), high transmittance (97.8%), and high strength (0.7 %w/w). In vitro release and ex vivo permeation of CVE6 were found to be substantially high as compared to anionic AVE6 and respective gels. Penetration study executed high fluorescence intensity with CVE6 and CVE6-gel as compared to suspension and ANE6 which may be attributed to electrostatic interaction between mucosal membrane and nanoglobules. Thus, cationic nanoemulsion and respective mucoadhesive gel are promising strategy for delivery of VA to brain through intransal administration for the treatment of seizure and convulsion.

In this study, we propose a radiomics-clinical probability weighted model for the prediction of prognosis for NSCLC. The model combines radiomics features extracted from RT planning images with clinical factors such as age, gender, histology, and tumor stage. CT images with radiotherapy structures of 422 NSCLC patients were retrieved from The Cancer Imaging Archive (TCIA). Radiomic features were extracted from gross tumor volume (GTV). Five machine learning algorithms, namely decision trees (DT), random forests (RF), extreme boost (EB), support vector machine (SVM) and generalized linear model (GLM), were optimized by a voted ensemble machine learning (VEML) model. A probabilistic weighted approach is used to incorporate the uncertainty associated with both radiomic and clinical features and to generate a probabilistic risk score for each patient. The performance of the model is evaluated using a receiver operating characteristic (ROC). Radiomic model, clinical factors model and combined radiomic-clinical probability weighted model demonstrated good performance in predicting NSCLC survival with AUC of 0.941, 0.856 and 0.949 respectively. The combined radiomics-clinical probability weighted enhanced model achieved significantly better performance than radiomic model in 1-year survival prediction (chi-square test, p<0.05). The proposed model has the potential to improve NSCLC prognosis and facilitate personalized treatment decisions.

Deep learning has been applied in many areas that have had a significant impact on applications that improves real-life challenges. The success of deep learning in a wide range of areas is due in part to the use of activation functions, which are particularly effective at solving non-linear problems. Activation functions are a key focus for researchers in artificial intelligence who aim to improve the performance of neural networks. This article provides a comprehensive explanation and comparison of different activation functions, with a focus on the arc tangent and its variations specifically. The paper presents experimental results that show that variations of the arc tangent using irrational numbers such as pi, the golden ratio, and Euler’s number, as well as a self-arctan function, produce promising results. Since we experimented with promising activation functions on two different problems, and datasets, we reached a result that different irrationals work well for different problems. In other words, arctan ϕ gives the best results mostly for multiclass classification and arctan e gives the best results for time series prediction problems. The paper focuses on a multi-class classification problem applied to the Reuters Newswire dataset and a time-series prediction problem on Türkiye energy trade value to show the impacts of activation functions.

Cities exposed their vulnerabilities during COVID-19 pandemic. Unprecedented policies restricted human activities but left an unique opportunity to quantify anthropogenic effects on urban air pollution. This study aimed to address the key questions of urban development behind the restrictions with the goal of supporting sustainable transition. Data from ground stations and Sentinel-5P satellite were used to assess the temporal and spatial anomalies of NO2. Beijing China was selected for a case study because this mega city maintained a “dynamic zero-COVID” policy with adjusted restrictions, allowing us better to track the effects. The time-series decomposition and prediction regression model were employed to estimate the normal NO2 levels in 2020. The anomalies between the observations and predictions as the deviation were identified due to the policy interventions and quantified different effects using spatial stratified heterogeneity statistics. The top three restrictions showing dominant effects were workplace closures, restricted public transport usage, and school closures, accounting for 54.8%, 52.3%, and 46.4% of NO2 anomalies, respectively; and they are directly linked to the mismatch of employment and housing (deter-mining the commuting patterns), educational inequality and the long-term unsolved road con-gestion. Promoting the transformation of urban spatial structure will effectively alleviate air pollution.

The task of determining the distance from one object to another is one of the important tasks solved in robotics systems. Conventional algorithms rely on an iterative process of predicting distance estimates, which results in an increased computational burden. Algorithms used in robotic systems should require minimal time costs, as well as be resistant to the presence of noise. To solve these problems, the paper proposes an algorithm for Kalman combination filtering with a Goldschmidt divisor and a median filter. Software simulation showed an increase in the accuracy of predicting the estimate of the developed algorithm in comparison with the traditional filtering algorithm, as well as an increase in the speed of the algorithm. The results obtained can be effectively applied in various computer vision systems.

Wheat (Triticum aestivum L.) breeding programs can take over a decade to release a new variety. However, new methods of selection such as genomic selection (GS) must be integrated to decrease the time it takes to release new varieties to meet the demand of a growing population. The implementation of GS into breeding programs is still being explored, with many studies showing its potential to change wheat breeding through achieving higher genetic gain. In this review, we explore the integration of GS for a wheat breeding program by redesigning the traditional breeding pipeline to implement GS. We propose implementing a two-part breeding strategy by differentiating between population improvement and product development. The implementation of GS in the product development pipeline can be integrated into most stages and can predict within and across breeding cycles. Additionally, we explore optimizing the population improvement strategy through GS recurrent selection schemes to reduce crossing cycle time and significantly increase genetic gain. The recurrent selection schemes can be optimized for parental selection, maintenance of genetic variation, and optimal cross-prediction. Overall, we outline the ability to increase the genetic gain of a breeding program by implementing GS and a two-part breeding strategy.

Men with non-small cell lung cancer (NSCLC) have a more favorable response to immune-checkpoint inhibitor (ICI) monotherapy, while women especially benefit from ICI-chemotherapy (CHT) combinations. To elucidate such sex differences in clinical practice, we retrospectively analyzed two cohorts treated with either ICI monotherapy (n=228) or ICI-CHT combination treatment (n=80) for advanced NSCLC. Kaplan-Meier analyses were used to calculate progression-free (PFS) and overall survival (OS), influencing variables were evaluated using Cox-regression analyses. No significant sex differences for PFS/OS could be detected in either cohort. Men receiving ICI monotherapy had a statistically significant independent impact on PFS by Eastern Cooperative Oncology Group performance status (ECOG) ≥2 (hazard ratio (HR) 1.90, 95% confidence interval (CI): 1.10-3.29, p=0.021), higher C-reactive protein (CRP; HR 1.06, 95%CI: 1.00-1.11, p=0.037) and negative programmed death-ligand 1 (PD-L1) status (HR 2.04, 95%CI: 1.32-3.15, p=0.001), and on OS by CRP (HR 1.09, 95%CI: 1.03-1.14, p=0.002). In men on ICI-CHT combinations, multivariate analyses (MVA) revealed squamous histology (HR 4.00, 95%CI: 1.41-11.2, p=0.009) significant for PFS; ECOG≥2 (HR 5.58, 95%CI: 1.88-16.5, p=0.002) and CRP (HR 1.19, 95%CI: 1.06-1.32, p=0.002) for OS. Among women undergoing ICI monotherapy, no variable proved significant for PFS, ECOG≥2 had a significant interaction with OS (HR 1.90, 95%CI 1.04-3.46, p=0.037). Women treated with ICI-CHT had significant MVA findings for CRP with both PFS (HR 1.09, 95%CI: 1.02-1.16, p=0.007) and OS (HR 1.11, 95%CI: 1.03-1.19, p=0.004). Although men and women responded similarly to both ICI mono- and ICI-CHT treatment, predictors of response differed by sex.

The Sugarcane yellow leaf virus (SCYLV) is associated with sugarcane yellow leaf disease (SCYLD) and is considered to be the most economically deleterious emerging pathogen that represents a potential threat and danger to sugarcane cultivation in China. Over the last two decades, high genetic diversity in the SCYLV genotypes was observed worldwide, with a greater chance of YLD incidence for sugarcane injury. SCYLV infection has significantly damaged its economic traits and is responsible for substantial losses in biomass production in sugarcane cultivars. This study aims to identify and comprehensively analyze sugarcane microRNAs (miRNAs) as therapeutic targets against SCYLV using plant miRNA prediction tools. Mature sugarcane miRNAs are retrieved and are used for hybridization of the SCYLV. A total of seven common sugarcane miRNAs were selected based on consensus genomic positions. The biologically significant, top ranked ssp-miR528 was consensually predicted to have a potentially unique hybridization site at nucleotide position 4162 for targeting the ORF5 of the SCYLV genome; this was predicted by all the algorithms used in this study. Then, the miRNA–mRNA regulatory network was generated using the Circos algorithm, which was used to predict novel targets. There are no acceptable commercial SCYLV-resistant sugarcane varieties available at present. Therefore, the predicted biological data offer valuable evidence for the generation of SCYLV-resistant sugarcane plants.

Corona viruses hijack human enzymes to assembly sugar coat on Spike glycoproteins. The mechanism that human antibodies may uncover the antigenic viral peptide epitopes hidden by sugar coat are unknown. In this study, we analyzed recombinant SARS-CoV-2 Spike protein secreted from BTI-Tn-5B1-4 cells, by trypsin and chymotrypsin digestion followed by mass spectrometry analysis. We acquired MS/MS spectrums for glycopeptides of all 22 predicted N-glycosylated sites. We further analyzed the surface accessibility of Spike proteins according to Cryo-EM and homolog-modeled structures, and available antibodies that bind to SARS-CoV-1. The results showed that all 22 N-glycosylated sites of SARS-CoV-2 are modified by high-mannose type of N-glycans. MS/MS fragmentation clearly established the glycopeptide identities. Electron densities of glycans cover most of the Spike receptor binding domain of SARS-CoV-2, except YQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQ, similar to a region FSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQ in SARS-CoV-1. Other surface-exposed domains included those located on Central Helix, between amino acids 967 and 1016 of SARS-CoV-1, and 985 to 1034 of SARS-CoV-2 Spike protein. As the majority of antibody paratopes bind to peptide portion with or without sugar modification, we propose a snake-catcher model that a minimal length of peptide is first clamped by a paratope, and the binding is either strengthened by sugars close to peptide, or not interfered by sugar modification.

Defects in pre-mRNA splicing are frequently a cause of Mendelian disease. Despite the advent of next-generation sequencing, allowing a deeper insight into a patient’s variant landscape, the ability to characterize variants causing splicing defects has not progressed with the same speed. To address this, recent years have seen a sharp spike in the number of splice prediction tools leveraging machine learning approaches, leaving clinical geneticists with a plethora of choices for in silico analysis. In this Review, some basic principles of machine learning are introduced in the context of genomics and splicing analysis. A critical comparative approach is then used to describe seven recent machine learning-based splice prediction tools, revealing highly diverse approaches and common caveats. We find that, although great progress has been made in producing specific and sensitive tools, there is still much scope for personalized approaches to prediction of variant impact on splicing. Such approaches may increase diagnostic yields and underpin improvements to patient care.

In the steeply inclined and extremely thick coal seams (SIETCS) mined using the horizontal sublevel top-coal caving (HSTCC) method, the uncertainty of gas emission is a safety threat to the mining operations. In order to reduce the occurrence of accidents, the determination of gas emission is crucial. In this paper, we first proposed a prediction model for workers at the floor coalbed to calculate gas emission on site. We then put forward a finite element numerical simulation for researchers to predict gas emission from the floor coalbed. At last, we measured gas emitted from the floor coalbed of SIETCS in Wudong Coal Mine in a specific mining period and used the data to verify the applicability and accuracy of these two gas-emission prediction methods. The results showed that the gas emission from Wudong Coal Mine was 1.08 m³/min calculated based on the prediction model and 1.07 m³/min obtained using the user-defined integration method. Both methods have their own advantages, disadvantages and applicable objects, and are important in predicting gas emission from SIETCS mined using HSTCC method.

Software fault prediction is the very consequent research topic for software quality assurance. Data driven approaches provide robust mechanisms to deal with software fault prediction. However, the prediction performance of the model highly depends on the quality of dataset. Many software datasets suffers from the problem of class imbalance. In this regard, under-sampling is a popular data pre-processing method in dealing with class imbalance problem, Easy Ensemble (EE) present a robust approach to achieve a high classification rate and address the biasness towards majority class samples. However, imbalance class is not the only issue that harms performance of classifiers. Some noisy examples and irrelevant features may additionally reduce the rate of predictive accuracy of the classifier. In this paper, we proposed two-stage data pre-processing which incorporates feature selection and a new Rough set Easy Ensemble scheme. In feature selection stage, we eliminate the irrelevant features by feature ranking algorithm. In the second stage of a new Rough set Easy Ensemble by incorporating Rough K nearest neighbor rule filter (RK) afore executing Easy Ensemble (EE), named RKEE for short. RK can remove noisy examples from both minority and majority class. Experimental evaluation on real-world software projects, such as NASA and Eclipse dataset, is performed in order to demonstrate the effectiveness of our proposed approach. Furthermore, this paper comprehensively investigates the influencing factor in our approach. Such as, the impact of Rough set theory on noise-filter, the relationship between model performance and imbalance ratio etc. comprehensive experiments indicate that the proposed approach shows outstanding performance with significance in terms of area-under-the-curve (AUC).

Cold-water coral reefs are rich, yet fragile ecosystems found in colder oceanic waters. Knowledge of their spatial distribution on continental shelves, slopes, seamounts and ridge systems is vital for marine spatial planning and conservation. Cold-water corals frequently form conspicuous carbonate mounds of varying sizes, which are identifiable from multibeam echosounder bathymetry and derived geomorphometric attributes. However, the often large number of mounds makes manual interpretation and mapping a tedious process. We present a methodology that combines image segmentation and random forest spatial prediction with the aim to derive maps of carbonate mounds and an associated measure of confidence. We demonstrate our method based on multibeam echosounder data from Iverryggen on the mid-Norwegian shelf. We identified the image-object mean planar curvature as the most important predictor. The presence and absence of carbonate mounds is mapped with high accuracy (overall accuracy = 84.4%, sensitivity = 0.827 and specificity = 0.866). Spatially-explicit confidence in the predictions is derived from the predicted probability and whether the predictions are within or outside the modelled range of values and is generally high. We plan to apply the showcased method to other areas of the Norwegian continental shelf and slope where MBES data have been collected with the aim to provide crucial information for marine spatial planning.

The philosophy of testing statistical hypothesis is a natural consequence and functional extension of mathematical analysis of Probability. Along with the concept of recurrence when applied to random sequences and functions, it leads to the analysis of a priori and posterior which implies testing statistical hypothesis. Testing statistical hypothesis also involves algebraic, functional and dimensional considerations, which are found in the works of Laplace. Aspects of mathematical analysis such as universality of solutions, Laws of Large Numbers, Entropy, Information, and various functional dependencies are the main factors explained in the five properties that lead to implication of testing statistical hypothesis. Various interesting examples with modern scientific significance from genetics, astrophysics, and other areas give methodological access to answers of different problems and phenomena which are involved in the logic of testing statistical hypothesis.

Predicting heart disease is crucial for early diagnosis and intervention, significantly improving patient outcomes and reducing mortality rates. This study compares various machine learning models, including Logistic Regression, Random Forest, Gradient Boosting, XGBoost, and Long Short-Term Memory (LSTM) networks, using the Cleveland Heart Disease dataset. Comprehensive preprocessing steps were undertaken, such as handling missing values, converting categorical variables to numeric forms, and binarizing the target variable for binary classification. Each model was rigorously evaluated using performance metrics, including accuracy, precision, recall, F1-score, and the area under the receiver operating characteristic curve (AUC-ROC). SHapley Additive exPlanations (SHAP) values were employed to provide insights into feature importance, ensuring model transparency and interpretability. The results indicate that XGBoost outperformed all other models, achieving an accuracy of 90% and an AUC-ROC of 0.94, demonstrating its superior ability to capture complex patterns in the data through advanced optimization techniques and regularization. This study highlights the significant potential of advanced machine learning techniques, particularly ensemble methods like Gradient Boosting and XGBoost, in enhancing heart disease prediction. These models offer higher accuracy and valuable interpretability, making them practical tools for early diagnosis in clinical settings. Future research should focus on integrating these models into healthcare systems and exploring hybrid approaches to further improve predictive performance and clinical applicability.

The growth rate in academic and scientific publications increased very fast. Researchers must choose a good representative and significant literature in publications, which has become challenging worldwide. Usually, the paper citation number indicates this paper's potential influence and importance. However, this standard metric of citation numbers cannot be used as a measurement to judge the popularity and significance of the recently published papers. To address this challenge, this paper presents an effective prediction method called FutureCite to predict the future citation level of research articles. FutureCite combines machine learning with text and graph mining techniques, leveraging their abilities in classification, datasets in-depth analysis, and feature extraction. FutureCite aims to predict future citation levels of research articles applying a multilabel classification approach. FutureCite can extract significant semantic features and capture the interconnection relationships found in scientific articles during feature extraction using textual content, citation networks, and metadata as feature resources. Our goal is to contribute to the advancement of substantial effective approaches impacting the citation counts in scientific publications by enhancing the precision of future citations. We conducted several experiments using a comprehensive publication dataset to evaluate our method and determine the impact of using a variety of machine learning algorithms. FutureCite demonstrated its robustness and efficiency and showed promising results based on different evaluation metrics. Using the FutureCite model has significant implications in improving the researchers' ability to determine targeted literature for their research and better understand the potential impact of research publications.

Improving the quality of petroleum products and refining processes through the use of artificial intelligence and machine learning techniques is the topic of this article. It shows that expert knowledge and conventional empirical models can't get you where you want to go in a refining process. To effectively capture complex interactions and forecast fuel qualities, machine learning techniques such as principal component analysis (PCA), support vector machines (SVM), artificial neural networks (ANN), and partial least squares (PLS) are suggested. Gasoline and other petroleum products, as well as property prediction, process control, product quality, and operational efficiency in refineries, can all be improved with the help of machine learning applied to spectral or distillation curve data. An exciting new direction in optimizing operations, meeting environmental norms, and precisely estimating gasoline quality is offered by advanced machine learning algorithms.