Artificial intelligence (AI) is a versatile term that is a conclusive remedy to solve the problem using past rational data after deep contemplation using these terms i-e basic statistics, carving data, familiarity with common AI algorithms. Seafood especially tiger prawn export as a busi-ness will provide enormous foreign exchange to any country if the farmers overcome the corre-lated vulnerabilities in prawn farming. This research is elucidating lacking in Tiger prawn (TP) farming like curbing of Oxygen, pH, water temperature, and nutrients, etc. Moreover, hatchery statistics in terms of juveniles will depict this study's clear picture of curbed aquaculture. For normative decisions, the Analytical Hierarchical Process (AHP) is used. The problem which has been faced by local prawn farmers that there is a stagnant TP growth in ponds, the reason is the predominant sensitivity factor in TP. For this reason, they need indemnification of thirteen fac-tors with natural resources to get the plausible results to get calmness in their lives. This study will solely focus on the TP growth model, and the monitoring effect will be established by the Artificial Intelligence algorithm. This study will employ the AHP, 0-1 scaling method, data cura-tion techniques, and ecological statistics. The life of Tiger Prawn (TP) depends upon these factors mainly, a) Physical and b) Chemical parameters. Physical parameters contain environment (E) provided to TP like season (S) and temperature (T) etc. whereas the quality of Ammonia NH3 (N) from fish waste, Oxygen level (O), and water quality hard & soft (W) lies in chemicals do-main. This research will Elucidate the factors which cause conceptual muddles in the aquamarine life of TP, for this reason, Statistical tools will assess the current result, forecast the gap. AHP will analyze the domain inputs, circumspect ramification which will depict visceral factors, later results depict which pond suits the TP. In curtail, these factors will be curbed to improve the growth of TP in a control conditioned environment.

The escalation of climate change and the increasing frequency of extreme weather events have amplified the importance of precise and timely lightning prediction. This predictive capability is pivotal for the preservation of life, protection of property, and maintenance of crucial infrastructure safety. Recently, the rapid advancement and successful application of data-driven deep learning across diverse sectors, particularly in computer vision and spatio-temporal data analysis, have opened up innovative avenues for enhancing both the accuracy and efficiency of lightning prediction. This article presents a comprehensive review of the broad spectrum of existing lightning prediction methodologies. Starting from traditional numerical forecasting techniques, we traverse the path to the most recent breakthroughs in deep learning research. We encapsulate these diverse methods, shedding light on their progression and summarizing their capabilities, while also predicting their future development trajectories. This exploration is designed to enhance our understanding of these methodologies, allowing us to better utilize their strengths, navigate their limitations, and potentially integrate these techniques to create novel and powerful lightning prediction tools. Through such endeavors, our aim is to bolster our preparedness against the growing unpredictability of our climate and ensure a proactive stance towards lightning prediction.

Background Acute kidney injury (AKI) is a common comorbidity in the intensive care unit (ICU), with higher mortality rate among those who receive continuous renal replacement therapy (CRRT). This study aimed to investigate the association of white blood cell (WBC) levels with all-cause mortality in AKI patients undergoing CRRT. Method We conducted a post hoc analysis of ICU patient data from multiple centers in Korea. First, the levels of WBCs were classified into four groups based on quartiles. Second, the relationship between different WBC levels and mortality was investigated with the Kaplan-Meier (K-M) survival curves, Cox proportional hazards model, and generalized additivity model (GAM). Finally, we used multiple imputation to avoid bias caused by non-randomized missing data. The endpoints were short-term (28 days) and long-term (90 days) mortality. Result In our analysis, a total of 1,100 ICU patients were included. Among them, 670 (60.90%) and 781 (71.00%) died within 28 and 90 days, respectively. K-M survival curves showed that patients with the lowest WBC levels had the highest risk of mortality for both outcomes. Adjusted multivariate Cox regression analysis confirmed that compared with the reference level (quartile 2), low WBC levels increased the risk of both 28-day mortality (quartile 1, HR = 1.43, 95% CI: 1.13–1.83, P = 0.004) and 90-day mortality (quartile 1: HR = 1.32; 95% CI: 1.05-1.66, P = 0.016). GAM analysis showed a non-linear, U-shaped relationship between pre-CRRT WBC levels and all-cause mortality (non-linear P < 0.05). Conclusion The baseline WBC level is an independent predictor of prognosis for ICU patients receiving CRRT. Patients in the lowest WBC quartile had the highest risk of all-cause mortality. These results provide further evidence that early observation and intervention may have a prognostic value for these high-risk patients.

During the last years, the increasing evidence of dietary antioxidant compounds and reducing chronic diseases and the relationship between diet and health have promoted an important innovation on the baked product sector, aiming at healthier formulations. This study aims to develop a tool based on mathematical models to predict baked goods total antioxidant capacity (TAC). The high variability of antioxidant properties of flours based on the aspects related to type of grains, varieties, proximal composition and processing, among others, makes very difficult to innovate on food product development without specific analysis. Using Total phenol content (TP), Oxygen radical absorbance capacity (ORAC) and Ferric reducing antioxidant power assay (FRAP) as proxies of antioxidant capacity. Three Bayesian-type models are proposed based on a double exponential parameterised curve that reflects the initial decrease and subsequent increase as a consequence of the observed processes of degradation and generation, respectively, of the antioxidant compounds. Once the values of the main parameters of each curve have been determined, support vector machines (SVR) with exponential kernel were used to predict, based on the temperature and duration of baking as well as the values of proteins and fibers of each native grain, the values of TAC during the baking time.

The growth of regularly generated data from many financial activities has significant implications for every corner of financial modeling. This study has investigated the utilization of these continuous growing data by a means of an automated process. The automated process can be developed by using Machine learning based techniques that analyze the data and gain experience from the underlying data. Different important domains of financial fields such as Credit card fraud detection, bankruptcy detection, loan default prediction, investment prediction, marketing and many other financial models can be modeled by implementing machine learning models. Among several machine learning based techniques, the use of parametric and non-parametric based methods are approached by this research. Two parametric models namely Logistic Regression, Gaussian Naive Bayes models and two non-parametric methods such as Random Forest, Decision Tree are implemented in this paper. All the mentioned models are developed and implemented in the field of Credit card fraud detection, bankruptcy detection, loan default prediction. In each of the aforementioned cases, the comparative study among the classification techniques is drawn and the best model is identified. The performance of each classifier on each considered domain is evaluated by various performance metrics such as accuracy, recall, precision, F1-score and mean squared error. In the credit card fraud detection model the decision tree classifier performs the best with an accuracy of 99.1% and, in the loan default prediction and bankruptcy detection model, the random forest classifier gives the best accuracy of 97% and 96.84% respectively.

The most common index for representing structural condition of the pavement is the structural number. The current procedure for determining structural numbers involves utilizing falling weight deflectometer and ground-penetrating radar tests, recording pavement surface deflections, and analyzing recorded deflections by back-calculation manners. This procedure has two drawbacks: 1. falling weight deflectometer and ground-penetrating radar are expensive tests, 2. back-calculation ways has some inherent shortcomings compared to exact methods as they adopt a trial and error approach. In this study, three machine learning methods entitled Gaussian process regression, m5p model tree, and random forest used for the prediction of structural numbers in flexible pavements. Dataset of this paper is related to 759 flexible pavement sections at Semnan and Khuzestan provinces in Iran and includes “structural number” as output and “surface deflections and surface temperature” as inputs. The accuracy of results was examined based on three criteria of R, MAE, and RMSE. Among the methods employed in this paper, random forest is the most accurate as it yields the best values for above criteria (R=0.841, MAE=0.592, and RMSE=0.760). The proposed method does not require to use ground penetrating radar test, which in turn reduce costs and work difficulty. Using machine learning methods instead of back-calculation improves the calculation process quality and accuracy.

The accuracy of sales prediction models based on the big data of online word-of-mouth (eWOM) is still not satisfied. We argue that eWOM contains heat and sentiments of different product dimensions, which can improve the accuracy of these models. In this paper, we propose a dynamic topic analysis (DTA) framework in order to extract heat and sentiments of product dimensions from the big data of eWOM. Finally, we propose an autoregressive-heat-sentiment (ARHS) model, which integrates heat and sentiments of dimensions into the baseline predictive model. The empirical study in movie industry confirms that heat and sentiments of dimensions can improve the accuracy of sales prediction model. ARHS model is better for movie box-office revenue prediction than other models.

Deep learning has been applied in many areas that have had a significant impact on applications that improves real-life challenges. The success of deep learning in a wide range of areas is due in part to the use of activation functions, which are particularly effective at solving non-linear problems. Activation functions are a key focus for researchers in artificial intelligence who aim to improve the performance of neural networks. This article provides a comprehensive explanation and comparison of different activation functions, with a focus on the arc tangent and its variations specifically. The paper presents experimental results that show that variations of the arc tangent using irrational numbers such as pi, the golden ratio, and Euler’s number, as well as a self-arctan function, produce promising results. Since we experimented with promising activation functions on two different problems, and datasets, we reached a result that different irrationals work well for different problems. In other words, arctan ϕ gives the best results mostly for multiclass classification and arctan e gives the best results for time series prediction problems. The paper focuses on a multi-class classification problem applied to the Reuters Newswire dataset and a time-series prediction problem on Türkiye energy trade value to show the impacts of activation functions.

The incidence of Type 1 Diabetes (T1D) in the Arab world, particularly, oil and gas rich Gulf Cooperative Council (GCC) countries has more than doubled in the last twenty years. Therefore, there is a dire need for careful systematic familial cohort studies, especially in high-risk populations. Several immunogenetic factors affect the pathogenesis of the disease. Genes in the human leukocyte antigen (HLA) account for the major genetic susceptibility to the disease. The triggering agents initiate disease onset by destruction of pancreatic β-cells. The autoantibodies against glutamic acid decarboxylase (GADA), insulinoma antigen-2 (IA-2A), insulin (IAA), and zinc transporter-8 (ZnT-8A) comprise the most reliable biomarkers for T1D in both children and adults. Although three of the GCC countries, namely Kuwait, Saudi Arabia and Qatar are among the top 10 countries with high incidence rate of T1D, no proper diagnostic and prediction tools were applied in the region. Understanding the disease sequelae in a homogenous gene pool with high consanguinity in the GCC could help solve the challenges in understanding pathogenesis, as well as hasten the prevention of T1D. Arab states must incorporate T1D predictive and intervention policies on a war-footing basis to minimize the burden of this serious disease.

This paper presents a new method of process parameters optimization, adequate for 3D printing of PLA (Polylactic Acid) components. The authors developed a new Hybrid Manufacturing Equipment (HME), suitable for producing complex parts made from a biodegradable thermoplastic polymer, for environmental sustainability. Our new HME equipment is producing PLA parts by both additive and subtractive techniques, with the aim of obtaining accurate PLA components with a good surface quality. A design of experiments has been applied for optimization purposes. The following manufacturing parameters were analyzed: rotation of the spindle, cutting depth, feed rate, layer thickness, nozzle speed, and surface roughness. Linear regression models and neural network models were developed to improve and predict the surface roughness of the manufactured parts. A new test part was designed and manufactured from PLA, to validate the new mathematical models, which can now be applied for producing complex parts made from polymer materials.

Predictive simulation of concurrent debris flow using only pre-disaster information has proven to be difficult as a result of problems in predicting the location of debris-flow initiation (i.e., slope failure). However, because catchment topography has concave characteristics, with all channels in a catchment joining each other as they flow downstream, it is possible to predict damage to downstream area using relatively inaccurate initiation points. Based on this, this paper presents methodologies employing debris-flow initiation points generated randomly using statistical slope failure prediction. A many-case simulation across numerous initiation points was performed to quantify the effect of slope-failure location in terms of deviations in the predicted water level and terrain deformation. It was found that the relative standard deviation diminished as the points approached the downstream area, indicating a location-based predictability effect.

In this study, a design of Morlet wavelet neural networks (MWNNs) is presented to solve the prediction differential model (PDM) using the global approximation capability of genetic algorithm (GA) and local quick interior-point algorithm scheme (IPAS), i.e., MWNN-GAIPAS. The famous PDM is known as a variant of functional differential system that works as an opposite of the historical delay differential models. A fitness function is optimized using the mean square error by applying the GA-IPAS for solving the PDM. Three PDM examples have been presented numerically to check the authenticity of the MWNN-GAIPAS. For the perfection of the designed MWNN-GAIPAS, the comparability of the obtained results and exact results is performed. Moreover, the neuron analysis is performed by taking the 3, 10 and 20 number of neurons. The statistical observations have been performed to authenticate the reliability of the MWNN-GAIPAS for solving the PDM.

Effectively avoiding gas accident is vital to the security of mineral manufacture, and the coal mine gas accident is often caused by gas concentration overrun. The prediction accuracy of gas emission quantity in coal mine is the key to solve this problem. To maintain concentration of gas in a secure range，grey theory and neural network model increasingly diffusely used in forecasting gas emission quantity in coal mine critically. Nevertheless, the limitation of the grey neural network model is that researchers merely bonded the conventional neural network and grey theory. To enhance accuracy of prediction, a modified grey GM(1,1) and RBF neural network model is proposed combined amended grey GM(1,1) model and RBF neural network model. Then the proposed model was put into simulation experiment which is built based on Matlab software. Ultimately, conclusion of the simulation experiment verified that the modified grey GM(1,1) and RBF neural network model not only boosts the precision of prediction, but also restricts relative error in a minimum range. This showed that the modified grey GM(1,1) and RBF neural network model achieves effectiveness in precision of prediction much better than grey GM(1,1) model and RBF neural network model.

In this communication, we present an innovative approach leveraging advanced Machine Learning (ML) and Artificial Intelligence (AI) techniques, specifically the Non-Negative Matrix Factorization (NMF) method, to analyze downward and upward light spectra collected by Hyperspectral Ocean Color Radiometer (HyperOCR, HOCR) sensors in the water column. Our work focuses on the development of a robust and efficient tool for unraveling the structure and activities of natural microbial assemblages in the ocean. By applying the NMF method to HyperOCR data, we successfully extracted five spectral signatures, representing unique patterns in the data. These signatures were instrumental in predicting the abundances of various microbial components, including bacteria, heterotrophic nanoflagellates, and picoeukaryotes, showcasing the potential of ML and AI in advancing oceanographic studies. To validate the methods, the study area included a shallow coastal area under the influence of freshwater inflow and an open offshore area with a depth of 100 m. The study sites in coastal and offshore waters (Kaštela Bay and Stončica Vis, respectively) had significantly different hydrographic and microbiological characteristics. Kaštela Bay had lower temperatures and salinity than the site on Vis. We have proved by application of different AI and ML methods with specific HOCR sensors prediction of the structure of the microbial community.

In order to realize the performance degradation trend prediction accurately, a prediction method based on multi-domain features and temporal convolutional network (TCN) is proposed. Firstly, construct a high-dimensional feature set in the multi-domain of vibration signals, and use comprehensive evaluation indicators to preliminarily screen performance degradation indexes with good sensitivity and strong trend. Secondly, the kernel principal component analysis (KPCA) method is adopted to eliminate redundant information between multi-domain features, and construct a health index (HI) based on convolutional auto-encoder (CAE) network. Thirdly, a TCN-based performance degradation trend prediction model is constructed, and direct multi-step prediction is used to predict the performance degradation trend of the monitored object. On this basis, the validity of the proposed method is verified using the bearing public data, and it is successfully applied to performance degradation trend prediction of rolling contact fatigue specimen. The results show that the feature set can be reduced from 14 dimensions to 4 dimensions by using KPCA, while 98.33% of the information of the original feature set is retained. Furthermore, the method of constructing HI based on CAE network is effective. The change process of the HI constructed truly reflects the performance degradation process of the rolling contact fatigue specimen. Compared with the two commonly used HI construction methods, auto-encoding (AE) network and gaussian mixture model (GMM), this method has obvious advantages. At the same time, the prediction model based on TCN can accurately predict the performance degradation of the rolling contact fatigue specimen with the root mean square error 0.0146 and the mean absolute error 0.0105, which has better performance and higher prediction accuracy than the prediction model based on the long short-term memory (LSTM) network and the gated recurrent unit (GRU). This method has general significance and may be extended to the performance degradation prediction of other mechanical equipment/parts.

Internet of Things (IoT) technologies can greatly benefit from machine learning techniques and Artificial Neural Networks for data mining and vice versa. In the agricultural field, this convergence could result in the development of smart farming systems suitable for use as decision support systems by peasant farmers. This work presents the design of a smart farming system for crop production, which is based on low-cost IoT sensors and popular data storage services and data analytics services on the Cloud. Moreover, a new data mining method exploiting climate data along with crop production data is proposed for the prediction of production volume from heterogeneous data sources. This method was initially validated using traditional machine learning techniques and open historical data of the northeast region of the state of Puebla, Mexico, which were collected from data sources from the National Water Commission and the Agri-food Information Service of the Mexican Government.

While the simple model of the total atmospheric carbon sink effect as a linear function of concentration has provided excellent prediction results, several problems remained to be investigated and solved. The most obvious open issue is the correct treatment of land use change emssions. It turns out that the model improves by mostly neglecting them after 1959. This effectively implies that land use change emissions have been constant and small since then. The key investigation starts with the observation, that the total carbon sink has a short term component which be explained by temperature changes commonly known as El Nin˜o. The apparent paradox is analysed and explained, why contrary to the short term changes no temperature caused trend can be detected in the model, despite the fact that several contributing processes exhibit temperature dependency. The result of this analysis leads to the model extension, where the total effect of sinks and natural emissions are a linear function of concentration and temperature. This model not only explains current measurements but also paleo climate from ice-core time series.

Over the past two decades, persistent occurrences of harmful algal blooms (HAB; Karenia brevis) have been reported in Charlotte County, southwestern Florida. We developed data-driven models that rely on spatiotemporal remote sensing and field data to identify factors controlling HAB propagation, provide a same-day distribution (nowcasting), and forecast their occurrences up to three days in advance. We constructed multivariate regression models using historical HAB occurrences (213 events reported from January 2010 to October 2017) compiled by the Florida Fish and Wildlife Conservation Commission and validated the models against a subset (20%) of the reported historical events. The models were designed to specifically capture the onset of the HABs instead of those that developed days earlier and continued thereafter. A prototype of an early warning system was developed through a threefold exercise. The first step involved the automatic downloading and processing of daily Moderate Resolution Imaging Spectroradiometer (MODIS) Aqua products using SeaDAS ocean color processing software to extract temporal and spatial variations of remote sensing-based variables over the study area. The second step involved the development of a multivariate regression model for same-day mapping of HABs and similar subsequent models for forecasting HAB occurrences one, two, and three days in advance. Eleven remote sensing variables and two non-remote sensing variables were used as inputs for the generated models. In the third and final step, model outputs (same-day and forecasted distribution of HABs) were posted automatically on a web-based GIS (http://www.esrs.wmich.edu/webmap/bloom/). Our findings include the following: (1) the variables most indicative of the timing of bloom propagation are bathymetry, euphotic depth, wind direction, SST, chlorophyll-a [OC3M] and distance from the river mouth, and (2) the model predictions were 90% successful for same-day mapping and 65%, 72% and 71% for the one-, two- and three-day advance predictions, respectively. The adopted methodologies are reliable, dependent on readily available remote sensing data sets, and cost-effective and thus could potentially be used to map and forecast algal bloom occurrences in data-scarce regions.

In recent years, cryptocurrencies have received substantial attention from investors, researchers and the media due to their volatile behaviour and potential for high returns. This interest has led to an expanding body of research aimed at predicting cryptocurrency prices, which are notably influenced by a wide array of technical, sentimental, and legal factors. This paper reviews scholarly content from 2014 to 2024, employing a systematic approach to explore advanced quantitative methods for cryptocurrency price prediction. It encompasses a broad spectrum of predictive models, from early statistical analyses to sophisticated machine and deep learning algorithms. Notably, this review identifies and discusses the integration of emerging technologies such as Transformers and hybrid deep learning models, which offer new avenues for enhancing prediction accuracy and practical applicability in real-world scenarios. By thoroughly investigating various methodologies and parameters influencing cryptocurrency price predictions, including market sentiment, technical indicators, and blockchain features, this review highlights the field’s complexity and rapid evolution. The analysis identifies significant research gaps and under-explored areas, providing a foundational guideline for future studies. These guidelines aim to connect theoretical advancements with practical, profit-driven applications in cryptocurrency trading, ensuring that future research is both innovative and applicable.

(1) Background: TNF inhibitors (TNFi) have revolutionized the treatment of rheumatoid arthritis (RA). However, 30-40 % of RA patients do not respond adequately to those biologics. In addition to neutralizing soluble TNF, TNFi have the ability to bind the transmembrane form of TNF, tmTNF. Importantly, tmTNF can act itself as a receptor that induces a “Reverse Signaling” (RS) in cells. We previously showed that certolizumab, a Fab’ TNFi, activates RS in human primary monocytes, at least in part through the transcription factor NRF2 that is known to regulate the expression of genes involved in anti-inflammatory response and oxidative stress. (2) Methods: Here, we have developed an assay for the prediction of clinical response of RA patients to TNF inhibitors. This assay is based on mRNA quantitation of CD36 activation and of 6 genes induced by NRF2 following tmTNF RS in fresh monocytes. (3) Results: We could predict the response to anti-TNF monoclonal antibodies (mAbs) with 93.3 % accuracy. However, our method was not suitable for the prediction of the response to TNF soluble receptor etanercept. (4) Conclusions: We have developed a rather simple, short-term, test that can be standardized. Predicting the response to TNF mAbs will help physicians offer the best available treatment and provide patients with personalized medicine.

Accurate estimation of Remaining Useful Life (RUL) for aircraft engines is essential for ensuring safety and uninterrupted operations in the aviation industry. Numerous investigations have leveraged the success of attention-based Transformer architecture in sequence modeling tasks, particularly in its application to RUL prediction. These studies primarily focus on utilizing onboard sensor readings as input predictors. While various Transformer-based approaches have demonstrated improvement in RUL predictions, their exclusive focus on temporal attention within multivariate time series sensor readings, without considering sensor-wise attention, raises concerns about potential inaccuracies in RUL predictions. To address this concern, our paper proposes a novel solution in the form of a two-stage attention based hierarchical transformer (STAR) frame-work. This approach incorporates a two-stage attention mechanism, systematically addressing both temporal and sensor-wise attentions. Furthermore, we enhance the STAR RUL prediction framework by integrate hierarchical encoder-decoder structures to capture valuable information across different time scales. By conducting extensive numerical experiments with the CMAPSS datasets, we demonstrate that our proposed STAR framework significantly outperforms current state-of-the-art models for RUL prediction.

This paper explores the application of various machine learning techniques for predicting customer churn in the telecommunications sector. We utilized a publicly accessible dataset and implemented several models, including Artificial Neural Networks, Decision Trees, Support Vector Machines, Random Forests, Logistic Regression, and gradient boosting techniques (XGBoost, LightGBM, and CatBoost). To mitigate the challenges posed by imbalanced datasets, we adopted different data sampling strategies, namely SMOTE, SMOTE combined with Tomek Links, and SMOTE combined with Edited Nearest Neighbors. Moreover, hyperparameter tuning was employed to enhance model performance. Our evaluation employed standard metrics such as Precision, Recall, F1-Score, and the Receiver Operating Characteristic Area Under Curve (ROC AUC). Regarding the F1-Score metric, CatBoost demonstrates superior performance compared to other machine learning models, achieving an outstanding 93% following the application of Optuna hyperparameter optimization. In the context of the ROC AUC metric, both XGBoost and CatBoost exhibit exceptional performance, recording remarkable scores of 91%. This achievement for XGBoost is attained after implementing a combination of SMOTE with Tomek Links, while CatBoost reaches this level of performance after the application of Optuna hyperparameter optimization.

As the oil industry increasingly turns to unconventional low-permeability and low-porosity reservoirs, precise post-fracture production prediction is a pivotal instrument in investment de-cision-making, formulation of energy policies, and promotion of environmental assessments. Nevertheless, despite extensive research spanning decades, the precise post-fracture production prediction based on logging parameters remains an intricate task. In this study, we gathered ex-tensive logging data and segmented the post-frac gas production during well testing on the first day to enrich the dataset. Nine pipelines were then architected using various techniques of data preprocessing, feature extraction, and advanced machine learning models. Hyperparameter op-timization was executed via the GridsearchCV. To assess the efficacy of diverse models, metrics including the coefficient of determination (R2), standard deviation (SD), and root mean square error (RMSE) were invoked. Among the several pipelines explored, the PS-NN exhibited excellent predictive capability in specific reservoir contexts (an R2 value of 0.94 and an RMSE of 48.15). In essence, integrating machine learning with logging parameters effectively assesses reservoir productivity at multi-meter formation scales. This strategy not only mitigates uncertainties en-demic to reservoir exploration but also equips petroleum engineers with monitoring on reservoir dynamics, thereby facilitating reservoir development. Additionally, this approach provides res-ervoir engineers with an efficient way of reservoir performance oversight.

The Cancer Genome Atlas (TCGA) has classified papillary thyroid carcinoma (PTC) into indolent RAS-like and aggressive BRAF-like based on its distinct driver gene mutations. This study aimed to assess clinicopathology and pERK1/2 expression variations between BRAF-like and RAS-like PTCs and establish predictive models for BRAFV600E and RAS-mutated PTCs. A total of 222 PTCs underwent immunohistochemistry staining to assess pERK1/2 expression and Sanger sequencing to analyze the BRAF and RAS genes. Multivariate logistic regression was employed to develop prediction model. Independent predictors for the BRAFV600E mutation include a nuclear score of 3, the absence of capsules, an aggressive histology variant, and pERK1/2 levels exceeding 10% (X2=0.128, P&gt;0.05, AUC=0.734, P&lt;0.001). RAS mutation predictive model includes follicular histology variant and pERK1/2 expression &gt;10% (X2=0.174, P&gt;0.05, AUC=0.8, P&lt;0.001). We proposed using the prediction model concurrently with four potential combination group outcomes. PTC cases included in combination of low BRAFV600E-scoring group and high RAS-scoring group are categorized as RAS-like (adjOR=4.857, P=0.01, 95% CI=1.470-16.049). PTCs included in combination of high BRAFV600E-scoring group and low RAS-scoring group are categorized as BRAF-like PTCs (adjOR=3.091, P=0.001, 95% CI=1.594-5.995). The different prediction models indicate variations in biological behaviour between BRAF-like and RAS-like PTCs, necessitating adjustments in treatment approaches.

In South Korea, the residential real estate market is influenced not just by traditional supply and demand dynamics, but also by external factors such as housing policies and macroeconomic conditions. Given the significant role of housing assets in individual wealth, market fluctuations can have profound implications. While prior research has utilized variables like GDP growth rate, patent issuance, and birth rates, and employed models like LSTM and ARIMA for housing price predictions, many overlook key localized factors. Notably, the impact of subway stations and living SOC facilities on housing prices, especially in metropolitan areas, remains underexplored. This study addresses these gaps by analyzing usage trends across subway stations, assessing the influence of living SOC facilities on housing values, and identifying the optimal machine learning model for price predictions near transport hubs. Through a comparative analysis of machine learning techniques, we aim to provide insights for more informed housing price determinations, promoting a more stable real estate market.

The proton exchange membrane fuel cell (PEMFC) is a critical and essential component of zero-emission electro-hydrogen generators. An accurate prediction of its performance is important for optimal operation management and preventive maintenance of these generators. However, the prediction is not simple because the PEMFCs have complex electrochemical reactions with multiple nonlinear relations between operating variables as inputs and voltage as output. In this paper, we propose an efficient prediction approach based on XGBRegressor and Tree-structured Parzen Estimator. In addition, to better select relevant features, Kernel Principal Component Analysis and Mutual Information are jointly used. The proposed approach allows consideration of the dynamic operating conditions of the PEMFC. To test and validate the robustness of the proposed approach, a real data-set of ten PEMFCs was considered. Furthermore, a comparison study with traditional machine learning models, such as artificial neural networks and support vector machine regression, was investigated. The obtained results confirm that our model outperforms the considered traditionel machine learning models.

Coastal marine ecosystems worldwide, like Florida Bay, are increasingly affected by tide alteration and anthropogenic disturbances which affect water quality imbalance leading to algal blooms. Increased bloom persistence is a serious threat due to the long-lasting impact on processes like carbon cycle and services like species presence. However, exploring eco-environmental feedback patterns of algal blooms remains challenging and poorly investigated, also due to the paucity of data. Florida Bay, taken as an epitome, has long experienced algal blooms in its central and western regions, and in 2006 an unprecedented bloom occurred in the eastern habitats. We analyzed the occurrence of blooms from three perspectives: (1) the spatial spreading networks of chlorophyll-a (CHLa) that pinpoints source and unbalanced habitats; (2) the fluctuations of water quality factors pre- and post-bloom outbreaks to in assess environmental impacts of ecological dysbiosis and target prevention and control of algal of blooms; and (3) the biogeochemical-spreading network topological co-evolution to quantify ecosystemic stability and ecological shift likelihood in long-term. Here, we propose Transfer Entropy (TE) to quantify dynamical interactions between spatial areas and biogeochemical factors (ecosystem connectome) underpinning bloom emergence and spreading, as well as environmental effects; the Pareto principle is defined for identifying the salient eco-environmental interactions of CHLa. We quantified the spatial dynamics of algal blooms, and thus obtained areas in need for ecological monitoring and potential bloom control. Results show that algal blooms are increasingly persistent over space with long-term negative effects on water quality factor. A dichotomy is reported between spatial ecological corridors of spreading and biogeochemical networks as well as divergence from the optimal eco-organization: randomization of the former due to nutrients' overload and temperature increase leads to scale-free CHLa spreading and extreme outbreaks a posteriori. Subsequently this increases bloom persistence, turbidity and salinity with potentially strong ecological effects on highly biodiverse and vulnerable areas such as tidal flats and marshes. Algal blooms are important ecosystem regulators of nutrient cycles; however, beyond limit chlorophyll-a outbreaks cause aquatic species mortality due to their effect on water turbidity, nutrient balance (nitrogen and phosphorus in particular), salinity and temperature. Beyond compromising local environmental quality, socio-ecological services are also compromised at large scales, yet ecological assessment models like the one presented are in need of application in subtropical and tropical bays worldwide.

This paper presents the development and implementation of a machine learning model to estimate the future price of commodities in the Brazilian market from technical analysis indicators. For this, two databases were obtained regarding the commodities sugar, cotton, corn, soybean and wheat, which were submitted to the steps of data cleaning, pre-processing and subdivision. From the pre-processed data, recurrent neural networks of the long short-term memory type were used to perform the prediction of data in the interval of 1 and 3 days ahead. These models were evaluated using mean squared error, obtaining an accuracy between 0.00010 and 0.00037 on the test data for 1 day ahead and 0.00015 to 0.00041 for 3 days ahead. However, based on the results obtained, it can be stated that the developed model obtained a good prediction performance for all commodities evaluated.

ABSTRACT Background Ubiquitination plays an important role in protein post-translational processes and has been found to be involved in a number of regulatory functions including proteasome degradation, DNA repair, transcription, signal transduction, endocytosis, and sorting. As the identification of ubiquitination site is critical to furthering our understanding of the mechanism of ubiquitination, various experimental and machine learning methods have been used to conduct this task. It has been an important but challenging task to improve the accuracy of ubiquitination site prediction. In this research, we explore the possibility of improving the prediction performance of machine learning by incorporating grid search in the training process. Method We developed grid search procedures for each of six widely used machine learning methods including NB, LR, DT, SVM, LASSO, and KNN, and applied them to ubiquitination site prediction using the six PCP datasets that were previously developed. For each of the ML methods, we developed a set of values for each of the tunable hyperparameters available to the method. These sets of values then can be combined to form a large grid of hyperparameter settings, and each of these settings is used in the grid search. We integrated 5-fold cross-validation in grid search to train and test ML models and applied an additional independent validation procedure by conducting a pre-training 80-20 sample split. We evaluated the performance of the six methods by comparing them side by side for each of the six datasets. We also compared the grid search results with the results that were previously published without doing grid search. To optimize the prediction performance, we trained 1.1 million ML models in total through grid search. Results We compared the overall prediction performance of these six methods, as well as their prediction performance when working with balanced vs. imbalanced data, and large-scale vs. small-scale data. From the perspective of dataset, we find that the overall performance of every PCP dataset has been significantly improved in this study compared to the previous study, with the percentage increase of the average AUC of all six datasets ranging from 7.9% (PCP-4) up to 17.0% (PCP-1). From the perspective of method, we find that three out of four methods significantly benefit from grid search comparing to their previously published non-grid search results, with the maximum AUC improvement as high as 47% (LASSO on PCP-5), 43.3% (NB on PCP-1), and 33.7% (SVM on PCP-6). SVM overall ranks number one, followed by KNN as the number two performer based on their average AUCs on all datasets. But these two also ranked the top two (KNN 76 days and SVM 15 days) in terms of the total running time that they need to do grid search. We also find that SVM, KNN, and DT tend to handle small-scale and imbalanced datasets better, while LR, and LASSO are doing well with large-scale and balanced datasets. NB is more sensitive to data imbalance while less sensitive to the size of a dataset. Conclusions Our results show that using grid search has improved the performance of ubiquitination prediction significantly. We find that the performance of a method is closely related to its hyperparameter setting and the type of data it handles. Even though SVM is on average an outperformer, none of the methods can provide the best performance for all datasets. When sufficient computing resources are well accessible, grid search is an effective way to identify both a top performing model for a machine learning method and a suitable machine learning method for a particular dataset.

The accurate prediction of heat load profiles with a daily resolution is required for a broad range of applications such as potential studies, design, or predictive operation of heating systems. If the heat demand of a consumer is mainly caused by (production) processes independent of the ambient temperature, existing load profile prediction methods fail. To close this gap, this study develops two ex post machine learning models for the prediction of the heat demand with a daily resolution. The selected input features are commonly available to each consumer connected to public natural gas and electricity grids or operating an energy monitoring system: Ambient temperature, weekday, electricity consumption, and heat consumption of the last seven days directly before the predicted day. The study’s database covers electricity and natural gas consumption load profiles from 82 German consumers over a period of two years. Electricity and heat consumption correlate strongly with individual patterns for many consumers. Both, shallow and deep learning algorithms are evaluated. The highest accuracy is achieved by a Long Short Term Memory (LSTM) model with a median of R² of 0.94. The ex post model architecture makes the model suitable for automated anomaly detection in energy monitoring systems.

In cognitive radio systems, identifying spectrum opportunities is fundamental to efficiently use the spectrum. Spectrum occupancy prediction is a convenient way of revealing opportunities based on previous occupancies. Studies have demonstrated that usage of the spectrum has a high correlation over multidimensions which includes time, frequency, and space. Accordingly, recent literature uses tensor-based methods to exploit the multidimensional spectrum correlation. However, these methods share two main drawbacks. First, they are computationally complex. Second, they need to re-train the overall model when no information is received from any base station for any reason. Different than the existing works, this paper proposes a method for dividing the multidimensional correlation exploitation problem into a set of smaller sub-problems. This division is achieved through composite two-dimensional (2D)-long short-term memory (LSTM) models. Extensive experimental results reveal a high detection performance with more robustness and less complexity attained by the proposed method. The real-world measurements provided by one of the leading mobile network operators in Turkey validate these results.

Lung cancer is known as lung carcinoma. It is a disease which is malignant tumor leading to the uncontrolled cell growth in the lung tissue. Lung Cancer disease is one of the most prominent cause of death in all over world. Early detection of this disease can assist medical care unit as well as physicians to provide counter measures to the patients. The objective of this paper is to approach an automated tool that takes influential causes of lung cancer as input and detect patients with higher probabilities of being affected by this disease. A neural network classifier accompanied by cross-validation technique is proposed in this paper as a predictive tool. Later, this proposed method is compared with another baseline classifier Gradient Boosting Classifier in order to justify the prediction performance.

Several epidemiological models are being used around the world to project the number of infected individuals and the mortality rates of the COVID-19 outbreak. Advancing accurate prediction models is of utmost importance to take proper actions. Due to a high level of uncertainty or even lack of essential data, the standard epidemiological models have been challenged regarding the delivery of higher accuracy for long-term prediction. As an alternative to the susceptible-infected-resistant (SIR)-based models, this study proposes a hybrid machine learning approach to predict the COVID-19 and we exemplify its potential using data from Hungary. The hybrid machine learning methods of adaptive network-based fuzzy inference system (ANFIS) and multi-layered perceptron-imperialist competitive algorithm (MLP-ICA) are used to predict time series of infected individuals and mortality rate. The models predict that by late May, the outbreak and the total morality will drop substantially. The validation is performed for nine days with promising results, which confirms the model accuracy. It is expected that the model maintains its accuracy as long as no significant interruption occurs. Based on the results reported here, and due to the complex nature of the COVID-19 outbreak and variation in its behavior from nation-to-nation, this study suggests machine learning as an effective tool to model the outbreak. This paper provides an initial benchmarking to demonstrate the potential of machine learning for future research.

Several outbreak prediction models for COVID-19 are being used by officials around the world to make informed-decisions and enforce relevant control measures. Among the standard models for COVID-19 global pandemic prediction, simple epidemiological and statistical models have received more attention by authorities, and they are popular in the media. Due to a high level of uncertainty and lack of essential data, standard models have shown low accuracy for long-term prediction. Although the literature includes several attempts to address this issue, the essential generalization and robustness abilities of existing models need to be improved. This paper presents a comparative analysis of machine learning and soft computing models to predict the COVID-19 outbreak. Among a wide range of machine learning models investigated, two models showed promising results (i.e., multi-layered perceptron, MLP, and adaptive network-based fuzzy inference system, ANFIS). Based on the results reported here, and due to the highly complex nature of the COVID-19 outbreak and variation in its behavior from nation-to-nation, this study suggests machine learning as an effective tool to model the outbreak.

Prediction of stock groups values has always been attractive and challenging for shareholders. This paper concentrates on the future prediction of stock market groups. Four groups named diversified financials, petroleum, non-metallic minerals and basic metals from Tehran stock exchange are chosen for experimental evaluations. Data are collected for the groups based on ten years of historical records. The values predictions are created for 1, 2, 5, 10, 15, 20 and 30 days in advance. The machine learning algorithms utilized for prediction of future values of stock market groups. We employed Decision Tree, Bagging, Random Forest, Adaptive Boosting (Adaboost), Gradient Boosting and eXtreme Gradient Boosting (XGBoost), and Artificial neural network (ANN), Recurrent Neural Network (RNN) and Long short-term memory (LSTM). Ten technical indicators are selected as the inputs into each of the prediction models. Finally, the result of predictions is presented for each technique based on three metrics. Among all algorithms used in this paper, LSTM shows more accurate results with the highest model fitting ability. Also, for tree_based models, there is often an intense competition between Adaboost, Gradient Boosting and XGBoost.

An application of deep convolutional neural network and recurrence plot for financial market movement prediction is presented. Though it is challenging and subjective to interpret its information, the pattern formed by a recurrence plot provide a useful insight into the dy- namical system. We used a recurrence plot of seven financial time series to train a deep neural network for financial market movement predic- tion. Our approach is tested on our dataset and achieved an average of 53.25% classification accuracy. The result suggests that a well trained deep convolutional neural network can learn a recurrence plot and pre- dict a financial market direction.

We write the mutual information between an input speech utterance and its reconstruction by a Code-Excited Linear Prediction (CELP) codec in terms of the mutual information between the input speech and the contributions due to the short term predictor, the adaptive codebook, and the fixed codebook. We then show that a recently introduced quantity, the log ratio of entropy powers, can be used to estimate these mutual informations in terms of bits/sample. A key result is that for many common distributions and for Gaussian autoregressive processes, the entropy powers in the ratio can be replaced by the corresponding minimum mean squared errors. We provide examples of estimating CELP codec performance using the new results and compare to the performance of the AMR codec and other CELP codecs. Similar to rate distortion theory, this method only needs the input source model and the appropriate distortion measure.

Looking at different operating climatic conditions, the electrical behavior predicting photovoltaic modules gets very important. For the estimation of output power from photovoltaic (PV) plants this is a very essential and basic aspect. In this paper, the relationship between the I-V curve and the irradiation spectrum is discussed by combining the single diode model. An explicit elementary analytical model with two defined shape parameters is discussed and improved with three approximations and second order Taylor expansion. Then, the explicit elementary analytical model is investigated under varying conditions leveraging the four parameters I_ph, I₀, R_s and R_sh from the single diode model. The relationship between the physical parameters and the condition parameters are discussed and applied to extract the shape parameters at different scenarios. Considering the aging effect, the process of calculation to predict the I-V curve under different splitting spectra is simplified as follow: (1) two shape parameters are gotten from the I-V data at measurement reference conditions (MRC); (2) the short circuit current, open circuit voltage and shape parameters under any splitting spectrum can be calculated based on the relationship provided in article; (3) the performance of PV panel can be predicted with parameters. The validation of this model was experimentally proven leveraging monocrystalline silicon photovoltaic module with different splitting films. Results showed that the model accurately predicts the I-V characteristics for the examined PV modules at different irradiance spectra and cell temperatures. Moreover, the presented model performs superior compared to other investigated models when looking at accuracy and simplicity.

The use of machine learning techniques in predictive health care is on the rise with minimal data used for training machine-learning models to derive high accuracy predictions. In this paper, we propose such a system, which utilizes Heart Rate Variability (HRV) as features for training machine learning models. This paper further benchmarks the usefulness of HRV as features calculated from basic heart-rate data using a window shifting method. The benchmarking has been conducted using different machine-learning classifiers such as artificial neural network, decision tree, k-nearest neighbour and naive bays classifier. Empirical results using MIT-BIH Arrhythmia database shows that the proposed system can be used for highly efficient predictability of abnormality in heartbeat data series.

This paper proposes two fully-automatic machine-extracted linguistic features from an unlimited text input for Mandarin prosody generation. One is the punctuation confidence (PC) which measures the likelihood of inserting a major punctuation mark (PM) at a word boundary. Another is the quotation confidence (QC) which measures the likelihood of a word string to be quoted as a meaningful or emphasized unit in text. Because a major PM in a text is highly correlated with a prosodic break, and a quoted word string plays an important role in human language understanding, the two features potentially could provide useful information for prosody generation. The idea is first realized by employing conditional random field (CRF)-based models to predict major PMs, quoted word string locations, and their associated confidences, i.e., the PC and the QC, for each word boundary. Then, the predicted punctuations and their confidences are combined with traditional contextual linguistic features to predict prosodic-acoustic features. Both objective and subjective tests showed that the prosody generation with the proposed linguistic features performed better than the one without the proposed features. So, the proposed PC and QC are promising features for Mandarin prosody generation.

Subseasonal-to-seasonal (S2S) weather forecasting has improved in recent years, thanks partly to better representation of physical variables in models. For instance, realistic initializations of snow and soil moisture in models yield enhanced predictability on S2S time scales. Snow depth and soil moisture also mediate month-to-month persistence of near-surface air temperature. Here the role of snow depth as predictor of temperature one month ahead in the Northern Hemisphere is probed via two causal pathways. Through the first pathway, snow depth anomalies in month 1 cause snow depth anomalies in month 2, which then cause temperature anomalies in month 2. This pathway represents the snow–albedo feedback, as well as cooling due to insulation, emissivity and heat loss. It is active from fall to summer, and its effect peaks in March/April in the midlatitudes and in May/June at high latitudes. A complementary second pathway, where snow depth anomalies in month 1 cause soil moisture anomalies in month 2, which then cause temperature anomalies in month 2 through soil moisture–temperature feedbacks, is only active in spring and summer. Its effect peaks later in the warm season than the effect of the first pathway. Geographically, snow depth mediates north of, and soil moisture south of, the areas with the highest temperature predictability from snow depth. These results indicate that the two pathways describe complementary physical mechanisms. The first pathway embodies month-to-month persistence of snow depth, and the second pathway represents melting of snow from one month to the next.

The following article presents an analysis of the determinants of diabetes using a dataset containing the surveys of 2000 patients from the Frankfurt Hospital in Germany. The data were analyzed using the following models, namely: Tobit, Probit, Logit, Multinomial Logit, OLS, WLS with heteroskedasticity. The results show that the presence of diabetes is positively associated with "Pregnancies", "Glucose", "BMI", "Diabetes Pedigree Function", "Age" and negatively associated with "Blood Pressure". A cluster analysis is realized using the fuzzy c-Means algorithm optimized with the Elbow method and three clusters were found. Finally a confrontation among eight different machine learning algorithms is realized to select the best performing algorithm to predict the probability of patients to develop diabetes.

In the steeply inclined and extremely thick coal seams (SIETCS) mined using the horizontal sublevel top-coal caving (HSTCC) method, the uncertainty of gas emission is a safety threat to the mining operations. In order to reduce the occurrence of accidents, the determination of gas emission is crucial. In this paper, we first proposed a prediction model for workers at the floor coalbed to calculate gas emission on site. We then put forward a finite element numerical simulation for researchers to predict gas emission from the floor coalbed. At last, we measured gas emitted from the floor coalbed of SIETCS in Wudong Coal Mine in a specific mining period and used the data to verify the applicability and accuracy of these two gas-emission prediction methods. The results showed that the gas emission from Wudong Coal Mine was 1.08 m³/min calculated based on the prediction model and 1.07 m³/min obtained using the user-defined integration method. Both methods have their own advantages, disadvantages and applicable objects, and are important in predicting gas emission from SIETCS mined using HSTCC method.

There are guidelines on lactation following maternal analgo-sedative exposure, but these do not consider the effect of maternal fasting, nor fluid abstention on human milk macronutrient composition. We therefore performed a structured search (PubMed) on ‘human milk composition’ and screened title, abstract and full paper on ‘fasting’ or ‘abstention’ and ‘macronutrient composition’ (lactose, protein, fat, solids, triglycerides, cholesterol). This resulted in 6 papers and one abstract related to religious fasting (n=129 women) and observational studies in lactating women (n=23, healthy volunteers, fasting). These data reflect two different ‘fasting’ patterns: an acute (18-25h) model in 71 (healthy volunteers, Yom Kippur/Ninth of Av) women and a chronic fasting (Ramadan) model in 81 women. Changes were most related to electrolytes and were moderate, with almost no changes in macronutrients during acute fasting. We therefor conclude that neither short term fasting nor fluid abstention (18-25h) affect human milk macronutrient composition, so that women can be reassured when this topic were raised during consulting. Besides the nutritional relevance, this also matters as clinical research samples – especially to estimate analgo-sedative exposure by lactation - are commonly collected after maternal procedural sedation, associated with maternal fasting and physiology-based pharmacokinetic (PBPK) models assume stable human milk composition.

Highly nonlinear characteristics of lithium-ion batteries (LIBs) are significantly influenced by the external and internal temperature of the LIB cell. Moreover, cell temperature beyond the manufacturer’s specified safe operating limit could lead to thermal runaway and even fire hazards and safety concerns to operating personnel. Therefore, accurate information of cell internal and surface temperature of LIB is highly crucial for effective thermal management and proper operation of a battery management system (BMS). Accurate temperature information is also essential to BMS for the accurate estimation of various important states of LIB such as state of charge, state of health and so on. High capacity LIB pack, used in electric vehicles and grid-tied stationary energy storage system essentially consists of thousands of individual LIB cells. Therefore, installing a physical sensor at each cell especially at the cell core is not practically feasible from the solution cost, space and weight point of view. A solution is to develop a suitable estimation strategy which led scholars to propose different temperature estimation schemes aiming to establish a balance among accuracy, adaptability, modelling complexity and computational cost. This article presented an exhaustive review of these estimation strategies covering recent developments, current issues, major challenges, and future research recommendations. The prime intention is to provide a detailed guideline to the researchers and industries towards developing a highly accurate, intelligent, adaptive, easy to implement and compute efficient online temperature estimation strategy applicable to health-conscious fast charging and smart onboard BMS.

The food distribution process is responsible for significant quality loss in perishable products. However, preserving quality is costly and consumes a tremendous amount of energy. To tackle the challenge of minimizing transportation costs and CO2 emissions while also maximizing product freshness, a novel multi-objective model is proposed. The model integrates a vehicle routing problem with temperature, shelf life, and energy consumption prediction models, thereby enhancing its accuracy. Non-dominated sorting genetic algorithm II is adapted to solve the proposed model for the set of Solomon test data. The conflicting nature of these objectives and the sensitivity of the model to shelf life and shipping container temperature settings are analyzed. The results show that optimizing freshness objective degrade the cost and the emission objectives, and the distribution of perishable foods are sensible to the shelf life of the perishable foods and temperature settings inside the container.

High-rise building machines (HBMs) play a critical role in the successful construction of super-high skyscrapers, providing essential support and ensuring safety. The HBM’s climbing system relies on a jacking mechanism consisting of several independent jacking cylinders. A reliable control system is imperative to maintain a smooth posture of the construction steel platform (SP) under the action of the jacking mechanism. This research introduces three multivariate time series neural network models—namely, Long Short-Term Memory (LSTM), Gated Recurrent Unit (GRU), and Temporal Convolutional Network (TCN)—to predict the posture of HBM. The models take pressure and stroke measurements from the jacking cylinders as inputs, and their outputs determine the levelness of the SP and the posture of the HBM at various climbing stages. The development and training of these neural networks are based on historical on-site data, with the predictions subjected to thorough comparative analysis. All proposed neural network models exhibit the capability to dynamically predict the posture of the HBM during the climbing process, using data from sensors. Notably, the GRU model shows better predictive performance.

The task of determining the distance from one object to another is one of the important tasks solved in robotics systems. Conventional algorithms rely on an iterative process of predicting distance estimates, which results in an increased computational burden. Algorithms used in robotic systems should require minimal time costs, as well as be resistant to the presence of noise. To solve these problems, the paper proposes an algorithm for Kalman combination filtering with a Goldschmidt divisor and a median filter. Software simulation showed an increase in the accuracy of predicting the estimate of the developed algorithm in comparison with the traditional filtering algorithm, as well as an increase in the speed of the algorithm. The results obtained can be effectively applied in various computer vision systems.

Defects in pre-mRNA splicing are frequently a cause of Mendelian disease. Despite the advent of next-generation sequencing, allowing a deeper insight into a patient’s variant landscape, the ability to characterize variants causing splicing defects has not progressed with the same speed. To address this, recent years have seen a sharp spike in the number of splice prediction tools leveraging machine learning approaches, leaving clinical geneticists with a plethora of choices for in silico analysis. In this Review, some basic principles of machine learning are introduced in the context of genomics and splicing analysis. A critical comparative approach is then used to describe seven recent machine learning-based splice prediction tools, revealing highly diverse approaches and common caveats. We find that, although great progress has been made in producing specific and sensitive tools, there is still much scope for personalized approaches to prediction of variant impact on splicing. Such approaches may increase diagnostic yields and underpin improvements to patient care.

Every month teachers face the dilemma of what exercises should their students practice, and what their consequences are on long-term learning. Since teachers prefer to pose their own exercises, this generates a large number of questions, each one attempted by a small number of students. Thus, we couldn’t use models based on big data such as deep learning. Instead, we developed a simple to understand state-space model that predicts end-of-year national test scores. We used 2,386 online fourth-grade mathematic questions designed by teachers and each attempted by some of the 500 students in 24 low socioeconomic schools. We found that the state-space model predictions improved month-by-month and that in most months it outperformed linear regression models. Moreover, the state-space estimator provides for each month a direct mechanism to simulate different practice strategies and compute their impact on the end-of-year standardized national test. We built iso-impact curves based on two critical variables: the number of questions solved correctly in the first attempt and the total number of exercises attempted. This allows the teacher to visualize the trade-off between asking students to do exercises more carefully or doing more exercises. To the best of our knowledge, this model is the first of its kind in education. It is a novel tool that supports teachers drive whole classes to achieve long-term learning targets.

Transportation authorities aim to boost road safety by identifying risky locations and applying suitable safety measures. The Highway Safety Manual (HSM) is a vital resource for US transportation professionals, aiding in the creation of Safety Performance Functions (SPFs), which are predictive models for crashes. These models rely on Negative Binomial distribution-based regression and misinterpreting them due to unmet statistical assumptions can lead to erroneous conclusions, including inaccurately assessing crash rates or missing high-risk sites. The Florida Department of Transportation (FDOT) has introduced context classifications to HSM SPFs, complicating assumption violation identification. This study, part of an FDOT-sponsored project, investigates established statistical diagnostic tests to identify model violations and proposes a novel approach to determine optimal spatial regions for Empirical Bayes adjustment. This adjustment aligns HSM-SPFs with regression assumptions. The study employs a case study involving Florida roads. Results indicate that a 20-mile radius offers an optimal spatial sample size for modeling crashes of all injury levels, ensuring accurate assumptions. For severe injury crashes, which are less frequent and harder to predict, a 60-mile radius is suggested to fulfill statistical modeling assumptions. This methodology guides FDOT practitioners in assessing the conformity of HSM-SPFs with intended assumptions and determining appropriate region sizes.

Time-series analysis is a widely used technique across various fields and industries, as it helps in understanding, predicting, and forecasting the behavior of data points over time. These fields include but are not limited to finance, economics, healthcare, transportation, etc. In the case of this paper, we have focused on finance. Predicting future values of financial time series offers several benefits. Accurate forecasts can help investors make better decisions about their investments. To predict future values, deep learning algorithms are commonly used since it is an effective method with complex data. In this study, we conduct a study that investigates the use of different data pre-processing techniques on deep learning algorithms in predicting the time series values. To conduct this experimental study, we utilize an open source software, which using long short-term memory technique as the representative deep learning technique, published in github software code repository platform. With this study, we investigate the effects of autoencoder and discrete wavelet transform data pre-processing techniques in time-series prediction. We discuss the details of the experimental study and report our results. The results show that time series prediction (using backtesting methodology) without any data pre-processing leads to 12.6% for mean absolute percentage error. The results also show that, time series prediction with the data preprocessing techniques (Wavelet Transform and Stacked Autoencoder) lead to 3.4%

The problem of low soil fertility and limited research in agricultural data driven tools, may lead to low crop productivity which makes it imperative to research in applications of high throughput computational algorithms such as of machine learning (ML) for effective soil analysis and fertility status prediction in order to assist in optimal soil fertility management decision-making activities. However, difficulties in the choice of the key soil properties parameters for use in reliable soil nutrients analysis and fertility prediction. Also, individual ML algorithms setbacks and modelling expert implementation procedures subjectivity, may lead to exploitation of worst fertility level targets and soil fertility status targets classification models performance reported variations. This paper surveys state-of-affair in ML for agricultural soil nutrients analysis and fertility status prediction. Prominent soil properties and widely used classical modelling algorithms and procedures are identified. Empirically exploited fertility status target classes are scrutinized, and reported soil fertility prediction model performances are depicted. The three pass method, with mixed method of qualitative content analysis and qualitative simple descriptive statistics were used in this survey. Observably, the frequently used soil nutrients and chemical properties were organic carbon, phosphorus, potassium, and potential Hydrogen, followed by iron, manganese, copper and zinc. Predominant algorithms included Random Forest, and Naïve Bayes, followed by Support Vector Machine. Model performances varied, with highest accuracy 98.93% and 98.15% achieved by ensemble methods, and the least being 60%. Interdisciplinary ML related researchers may consider using ensemble methods to develop high performance soil fertility status prediction models.

Cold-water coral reefs are rich, yet fragile ecosystems found in colder oceanic waters. Knowledge of their spatial distribution on continental shelves, slopes, seamounts and ridge systems is vital for marine spatial planning and conservation. Cold-water corals frequently form conspicuous carbonate mounds of varying sizes, which are identifiable from multibeam echosounder bathymetry and derived geomorphometric attributes. However, the often large number of mounds makes manual interpretation and mapping a tedious process. We present a methodology that combines image segmentation and random forest spatial prediction with the aim to derive maps of carbonate mounds and an associated measure of confidence. We demonstrate our method based on multibeam echosounder data from Iverryggen on the mid-Norwegian shelf. We identified the image-object mean planar curvature as the most important predictor. The presence and absence of carbonate mounds is mapped with high accuracy (overall accuracy = 84.4%, sensitivity = 0.827 and specificity = 0.866). Spatially-explicit confidence in the predictions is derived from the predicted probability and whether the predictions are within or outside the modelled range of values and is generally high. We plan to apply the showcased method to other areas of the Norwegian continental shelf and slope where MBES data have been collected with the aim to provide crucial information for marine spatial planning.

Corona viruses hijack human enzymes to assembly sugar coat on Spike glycoproteins. The mechanism that human antibodies may uncover the antigenic viral peptide epitopes hidden by sugar coat are unknown. In this study, we analyzed recombinant SARS-CoV-2 Spike protein secreted from BTI-Tn-5B1-4 cells, by trypsin and chymotrypsin digestion followed by mass spectrometry analysis. We acquired MS/MS spectrums for glycopeptides of all 22 predicted N-glycosylated sites. We further analyzed the surface accessibility of Spike proteins according to Cryo-EM and homolog-modeled structures, and available antibodies that bind to SARS-CoV-1. The results showed that all 22 N-glycosylated sites of SARS-CoV-2 are modified by high-mannose type of N-glycans. MS/MS fragmentation clearly established the glycopeptide identities. Electron densities of glycans cover most of the Spike receptor binding domain of SARS-CoV-2, except YQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQ, similar to a region FSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQ in SARS-CoV-1. Other surface-exposed domains included those located on Central Helix, between amino acids 967 and 1016 of SARS-CoV-1, and 985 to 1034 of SARS-CoV-2 Spike protein. As the majority of antibody paratopes bind to peptide portion with or without sugar modification, we propose a snake-catcher model that a minimal length of peptide is first clamped by a paratope, and the binding is either strengthened by sugars close to peptide, or not interfered by sugar modification.

Burrs form due to plastic deformation of materials during machining processes, such as milling and drilling. Deburring can be very difficult when the burrs are not easily accessible for removal. In this study, abrasive flow machining (AFM) was adopted for deburring the edges of milling specimens. Based on the experimental observations on AL6061 specimens, the deburring performance was characterized in terms of flow speed, the local curvature of the streamline near the burr edge, and shear stress. A new objective function that can predict the extent of deburring is proposed based on these characteristics and validated through experiments. Based on this new objective function, a prediction of deburring performance on the burr edge of the intersecting holes with offset was performed. The results between the predicted and experimental observation results were in reasonable agreement.

Strong convective storms can be a serious threat to modern society, influencing both the economy and human life. Thunderstorms can bring much-needed rain after a dry spell, but the nature of thunderstorm mostly causes damage due to high wind associated with it and heavy intensity rain that mostly causes quick overlandflow and flashfloods. The paper focused on the 2011 Pukkelpop event in Belgium where due to heavy thunderstorm a lot of financial damage occurred, and five casualties. In this paper we look into the basic elements that enforces the creation of a thunderstorm like CAPE and windshear. A representative grid has been taken from the Alaro-0 model of 12.5 km resolution for the analysis of the thunderstorm over Belgium which is detailed out in the methodology. The model runs of Alaro-0 from Royal Meteorological Institute of Belgium (RMI) is used for historical and future years for CAPE and Shear. We look into STEnv which is a composite number that can provide some insight on occurrence of thunderstorm, and STEnv is when CAPE*Shear exceeds certain threshold. In this study the threshold has been chosen as 97%. Only summer months have been taken into account into this study as summer(s) has the most thunderstorm in Belgium. The analysis of CAPE and STEnv over historical period (1977-2005), near future (2041-2069) and far future (2071-2099) shows significant increase in occurrence of thunderstorm in the 2071-2099s, specially in extreme cases such as 97% and 99% quantile. CAPE (J/Kg) increases in all future scenarios compared to the historical period. In 2071-2099s, CAPE increases from 2100 J/Kg to 2300 J/Kg (90% quantile) and from 3500 J/Kg to 3900 J/Kg (99% quantile) compared to the historical period. The number of STEnv increases from 300 to 378 in top 10% storm case (90% quantile), 158 to 218 in top 5% storm (95% quantile), 97 to 153 in top 3% storm (97% quantile) and 33 to 66 in top 1% storm (99% quantile) with a 90% confidence interval overall. Shear mostly remains unchanged. The study also shows spatial variation of CAPE, shear and STEnv over Belgium for present and future scenarios in different extremities (90%, 95%, 97% and 99% quantiles). There is a good indication that increase in CAPE translates to increase in STEnv, which is an accepted measure to predict occurrence of thunderstorm. Future climate change also amplifies the occurrence of thunderstorm, which is coherent with relevant studies. The uncertainty related to the study can be reduced with more detailed dataset and involvement of numerical weather prediction models beyond data statistics.

(1) Birth asphyxia is the major cause for delivery room resuscitation. Subsequent organ failure and hypoxic-ischemic encephalopathy (HIE) account for 25% of all early postnatal deaths. The neonatal Sequential Organ Failure Assessment (nSOFA) considers platelet count, respiratory and cardiovascular dysfunction in neonates with sepsis. To evaluate whether nSOFA is also a useful predictor for in-hospital mortality in neonates (≥ 36+0 weeks of gestation (GA)) following asphyxia with HIE and therapeutic hypothermia (TH), (2) nSOFA was documented at ≤ 6 hours of life. (3) 65 infants fulfilled inclusion criteria for TH. All but one infant received cardiopulmonary resuscitation and/or respiratory support at birth. nSOFA was lower in survivors (median 0 [IQR 0-2]; n = 56, median GA 39+3, female n = 28 (50%)) than in non-survivors (median 10 [4-12], p < 0.001; n = 9, median GA 38+6, n = 4 (44.4%)). This was also observed for the respiratory (p < 0.001), cardiovascular (p < 0.001), and hematologic sub scores (p = 0.003). The odds ratio for mortality was 1.6 [95% CI = 1.2 – 2.1] per one-point increase in nSOFA. The optimal cut-off value of nSOFA to predict mortality was 3.5 (sensitivity 100.0%, specificity 83.9%). (4) Since early accurate prognosis following asphyxia with HIE and TH is essential to guide end-of-life decisions, nSOFA (≤ 6 hours of life) offers the potential to identify infants at risk of mortality.

Concussion, also known as mild traumatic brain injury (mTBI), commonly causes transient neurocognitive symptoms, but in some cases, it causes cognitive impairment, including working memory (WM) deficit, which can be long-lasting and impede a patient’s return to work. The predictors of long-term cognitive outcomes following mTBI remain unclear because abnormality is often absent in structural imaging findings. The purpose of the study was to determine whether machine learning-based models using functional magnetic resonance imaging (fMRI) biomarkers and demographic or neuropsychological measures at baseline could effectively predict 1-year cognitive outcomes of concussion. We conducted a prospective, observational study of patients with mTBI who were compared with demographically-matched healthy controls enrolled between September 2015 to August 2020. Baseline assessments were collected within the first week of injury, and follow-ups were conducted at 6 weeks, 3 months, 6 months, and 1 year. Potential demographic, neuropsychological, and fMRI features were selected according to the significance of correlation with the estimated changes in WM ability. The support vector machine classifier was trained using these potential features and estimated changes in WM between the predefined time periods. Patients demonstrated significant cognitive recovery at the third month, followed by worsened performance after 6 months, which persisted until 1 year after concussion. Approximately half of the patients experienced prolonged cognitive impairment at 1-year follow up. Satisfactory predictions were achieved for patients whose WM function did not recover at 3 months (accuracy=87.5%), 6 months (accuracy=83.3%), 1 year (accuracy=83.3%), and performed worse at 1-year follow-up compared to baseline assessment (accuracy=83.3%). This study demonstrated the feasibility of personalized prediction for long-term postconcussive WM outcomes based on baseline fMRI and demographic features, opening a new avenue for early rehabilitation intervention in selected individuals with possible poor long-term cognitive outcomes.

Environmental monitoring systems play a crucial role in assessing environmental quality, detecting limits exceedances, and predicting potential ecological episodes. These systems rely on the measurement of various variables at specific locations and time intervals over an extended period. The concept of environmental monitoring encompasses the assessment of health and safety issues for public and environmental health purposes. Pollution of the atmosphere and water, climate change, and natural disasters are among the consequences of continuous industrial and municipal development and human interference in natural ecosystems. To address these challenges and to protect human lives and the environment, with a special concern on mitigating the ecological effects of industrial development, advanced technical solutions, including the technologies associated with artificial intelligence (artificial neural networks ANNs, machine learning ML) have been developed. These technologies offer powerful tools for analysing the vast amount of data collected by monitoring systems and extracting valuable insights. By applying ANNs and machine learning algorithms, environmental monitoring systems can effectively process and interpret the measured variables to assess environmental quality. Despite challenges and limitations, such as data quality and interpretability of AI models, ongoing research and interdisciplinary collaboration are paving the way for the successful implementation of AI in environmental monitoring, ultimately supporting informed decision-making and sustainable resource management.While several review papers have explored the theory of artificial intelligence (AI), here I aim to review the application of ANNs and ML, in environmental aspects, specifically in automotive and industrial emissions toxicity measurements, as well as atmospheric pollution prevention. By examining the potential of AI in these domains, the paper contributes to understanding the role of advanced technologies in environmental monitoring and protection.

Cities exposed their vulnerabilities during COVID-19 pandemic. Unprecedented policies restricted human activities but left an unique opportunity to quantify anthropogenic effects on urban air pollution. This study aimed to address the key questions of urban development behind the restrictions with the goal of supporting sustainable transition. Data from ground stations and Sentinel-5P satellite were used to assess the temporal and spatial anomalies of NO2. Beijing China was selected for a case study because this mega city maintained a “dynamic zero-COVID” policy with adjusted restrictions, allowing us better to track the effects. The time-series decomposition and prediction regression model were employed to estimate the normal NO2 levels in 2020. The anomalies between the observations and predictions as the deviation were identified due to the policy interventions and quantified different effects using spatial stratified heterogeneity statistics. The top three restrictions showing dominant effects were workplace closures, restricted public transport usage, and school closures, accounting for 54.8%, 52.3%, and 46.4% of NO2 anomalies, respectively; and they are directly linked to the mismatch of employment and housing (deter-mining the commuting patterns), educational inequality and the long-term unsolved road con-gestion. Promoting the transformation of urban spatial structure will effectively alleviate air pollution.

While thunderstorms can pose severe risks to property and life, forecasting remains challenging, even at short lead times, as these often arise in meta-stable atmospheric conditions. In this paper, we examine the question of how well we could perform short-term (up to 180min) forecasts using exclusively multi-spectral satellite images and past lighting events as data. We employ representation learning based on deep convolutional neural networks in an “end-to-end” fashion. Here, a crucial problem is handling the imbalance of the positive and negative classes appropriately in order to be able to obtain predictive results (which is not addressed by many previous machine-learning-based approaches). The resulting network outperforms previous methods based on physically-based features and optical flow methods (similar to operational prediction models) and generalizes across different years. A closer examination of the classifier performance over time and under masking of input data indicates that the learned model actually draws most information from structures in the visible spectrum, with infrared imaging sustaining some classification performance during the night.

As precision medicine such as targeted therapy and immunotherapy often have limited accessibility, low response rate and evolved resistance, it is urgent to develop simple, low-cost, and quick-turnaround personalized diagnostic technologies for drug response prediction with high sensitivity, speed, and accuracy. Major challenges of drug response prediction strategies employing digital database modeling are the scarcity of labeled clinical data, applicable only to a few classes of drugs, and losing the resolution at the individual patient level. Although these challenges have been partially addressed by large-scale cancer cell line datasets and more patient-relevant cell-based systems, the integration of different data types and data translation from pre-clinical to clinical utilities are still far-fetched. To overcome current limitations of precision medicine with a clinically proven drug response prediction assay, we have developed an innovative and proprietary technology based on in vitro patient testing and in silico data analytics. First, a patient-derived gene expression signature was established via transcriptomic profiling of cell-free mRNA (cfmRNA) from the patient’s blood. Second, a gene-to-drug data fusion and overlaying mechanism to transfer data was performed. Finally, a semi-supervised method was used for database searching, matching, annotation and ranking of drug efficacies from a pool of ~700 approved, investigational or clinical trial drug candidates. A personalized drug response report can be delivered to inform clinical decision within a week. The PGA (Patient-derived Gene expression-informed Anticancer drug efficacy) test has significantly improved patient outcomes when compared to the treatment plans without PGA support. Implementation of PGA, which combines patient-unique cfmRNA fingerprints with drug mapping power, has the potential to identify treatment options when patients are no longer responding to therapy and when standard-of-care is exhausted.

The assessment of concrete structures' durability in chlorine environments is significantly impacted by the uncertainty inherent in existing durability models. It introduce an integrated approach for updating these models, based on detection information of existing structures. This approach narrows the gap between theoretical predictions and observed structural durability. Specifically, we refine the probability model of critical chloride content by analyzing steel bar corrosion sample proportions, using Bayesian theory for greater accuracy. The enhanced model enables more reliable life expectancy prediction, forming a solid foundation for maintaining and strengthening existing structures.This method was demonstrated through a case study of a reinforced concrete industrial building with a service life of 12 years.

Estimating the Remaining Useful Life (RUL) of aircraft engines holds a pivotal role in enhancing safety, optimizing operations, and promoting sustainability, thus being a crucial component of modern aviation management. Precise RUL predictions offer valuable insights into an engine’s condition, enabling informed decisions regarding maintenance and crew scheduling. In this context, we propose a novel RUL prediction approach in this paper, harnessing the power of Bi-directional LSTM and Transformer architectures, known for their success in sequence modeling, such as natural languages. We adopt the encoder part of the full Transformer as the backbone of our framework, integrating it with a self-supervised denoising autoencoder that utilizes Bidirectional LSTM for improved feature extraction. Within our framework, a sequence of multivariate time series sensor measurements serves as the input, initially processed by the Bidirectional LSTM autoencoder to extract essential features. Subsequently, these feature values are fed into our Transformer encoder backbone for RUL prediction. Notably, our approach simultaneously trains the autoencoder and Transformer encoder, different from the naive sequential training method. Through a series of numerical experiments carried out on the C-MAPSS datasets, we demonstrate that the efficacy of our proposed models either surpasses or stands on par with that of other existing methods.

The COVID-19 pandemic has significantly impacted global health and economies, necessitating the development of effective vaccines against the novel virus. Understanding the structure and function of SARS-CoV-2 is crucial for rational vaccine design. The virus consists of several key proteins, including the spike protein, envelope protein, membrane protein, and nucleocapsid protein. The spike protein plays a crucial role in host cell entry by binding to the angiotensin-converting enzyme 2 (ACE2) receptor on human cells. The replication of the virus within host cells is facilitated by various viral proteins, such as the RNA-dependent RNA polymerase (RdRp) and the main protease (Mpro). Rational vaccine design strategies for SARS-CoV-2 primarily focus on targeting the spike protein due to its role in host cell entry. However, developing vaccines against this protein is challenging due to its highly mutable nature and potential conformational changes. Alternative strategies involve using other viral proteins, such as the nucleocapsid protein, which is conserved and essential for viral replication. Considering T-cell responses in vaccine design is also vital as they play a vital role in controlling viral infections. Vaccines that elicit both antibody and T-cell responses are more likely to provide robust and durable immunity against SARS-CoV-2. Advancements in rational vaccine design for SARS-CoV-2 include mRNA-based vaccines, viral vector-based vaccines, and protein subunit vaccines. However, challenges remain in developing a universally effective vaccine, including the emergence of new SARS-CoV-2 variants and mutations that may affect the efficacy of existing vaccines. In conclusion, rational vaccine design for SARS-CoV-2 requires a comprehensive understanding of the virus's structure and function, targeting key viral proteins, and considering T-cell responses.

Air quality is one of the most concerning problems in major industrialized cities in the world. Prediction of future air quality is highly relevant to public health. In some big cities, multiple air quality measurement stations are deployed at different locations to monitor air pollutants, such as NO2, CO, PM 2.5 and PM 10, over time. At every monitoring time stamp t, we observe one station×feature matrix xt of the pollutant data, which represents a spatio–temporal process. Traditional methods on prediction of air quality typically use data from one station or can only predict a single pollutant (such as PM 2.5) at a time, which ignores the spatial correlation among different stations. Moreover, the air pollution data are typically highly nonstationary, We propose a de-trending graph convolutional LSTM (long short term memory) to continuously predict the whole station×feature matrix in the next 1 to 48 hours, which not only captures the spatial dependency among multiple stations by replacing an inner product with convolution, but also incorporates the de-trending signals (transform a nonstationary process to a stationary one by differencing the data) into our model. Experiments on the air quality data of the city Chengdu and multiple major cities in China demonstrate the feasibility of our method and show promising results.

Accurate prediction of the degree of airport delays under the influence of convective weather is crucial for collaborative traffic management implementation and improving the efficiency of airport operations. However, existing studies usually only consider numerical-type quantitative features of weather-affected traffic in their models, and lack the introduction of spatial information to comprehensively portray the traffic operation scenarios under the influence of weather. In order to overcome this problem, this paper firstly designs a new image representation of weather-affected air traffic, and constructs a multi-channel traffic and weather scene image (MTWSI) by populating the airspace two-dimensional grid with traffic and meteorological information to represent the overall traffic operation situation in the terminal area under the influence of convective weather; then, a deep convolutional neural network-based airport delay prediction model ( ADLCNN), which takes MTWSI images as input and uses a specific CNN model to extract the deep features that affect traffic operation in it to input into the subsequent classification algorithm to predict the flight delay level; finally, a series of comparative experiments are carried out on the operational data of Guangzhou Baiyun Airport, and the experimental validation shows that, compared with the traditional machine learning methods, the proposed CNN-based airport delay prediction The experimental validation shows that the proposed CNN-based airport delay prediction model has satisfactory prediction performance compared with the traditional machine learning methods, which also proves that the proposed MTWSI method can more comprehensively respond to the real traffic conditions.

Generally, when cognitive radio users are in Underlay mode, through the analysis of the electromagnetic spectrum in time, frequency, space, and field of multiple dimensional data accounts for judging the inherent correlation of the radio spectrum used/idle state, this is the realization of cognitive radio users (secondary users, SUs) efficient access to the foundation of the limited spectrum resources. Therefore, how to efficiently use of spectrum status of each SU implementation of reception multidimensional combination forecasting is the core of this paper addressing the problem. In this paper, we propose a deep-learning hybrid model called TensorGCN-LSTM based on the tensor data structure. The model treats SUs deployed at different spatial locations under the same frequency and the spectrum status of SUs themselves under different frequencies in the task area as nodes and constructs two types of graph structures. Graph convolutional operations are used to sequentially extract corresponding spatial-domain and frequency-domain features from the two types of graph structures. Then, the long short-term memory (LSTM) model is used to fuse the spatial, frequency, and temporal features of the cognitive radio environment data. Finally, the prediction task of the spectrum distribution situation is accomplished through fully connected layers. Specifically, the model constructs a tensor graph based on the spatial similarity of SUs' locations and the frequency correlation between different frequency signals received by SUs, which describes the electromagnetic wave's dependency relationship in spatial and frequency domains. LSTM is used to capture the electromagnetic wave's dependency relationship in the temporal domain. To evaluate the effectiveness of the model, we conducted ablation experiments on LSTM, GCN, GC-LSTM, and TensorGCN-LSTM models using simulated data. The experimental results show that our model achieved better prediction performance in RMSE, and the correlation coefficient R2 of 0.8753 also confirmed the feasibility of the model.

The deployment of a manufacturing execution system (MES) holds promising potential in facilitating the accumulation of a substantial amount of inspection data. Low quality levels in discrete manufacturing environments are the result of multi-factor coupling and failure to find quality issues in a timely manner within manufacturing settings may trigger the propagation of defects downstream. Currently, most of the inspection quality methods are direct measurement followed by manual judgment. The integration of deep learning methods provides a feasible way to identify defects in a timely manner, thus improving the acceptance rate of factories. This paper focuses on the design of a data-driven quality prediction and control model around discrete manufacturing characteristics, and use fuzzy theory to evaluate the quality level of production stages. Building Multivariate Long and short-term memory learning hidden quality representations to extract predictions from multi-level inspection data in manufacturing systems. Finally, by validating the data of actual produced water dispensers according to three evaluation indexes, RMSE, MAE, MAPE, the results show that Multivariate Long and short-term memory has better prediction performance.

The used car market has a high global economic importance, with more than 35 million cars sold yearly. Accurately predicting prices is a crucial task for both buyers and sellers to facilitate informed decisions in terms of opportunities or potential problems. Although various Machine Learning techniques have been applied to create robust prediction models, a comprehensive approach has yet to be studied. This research introduces two datasets from different markets, one with over 300,000 entries from Germany to serve as a training base for deep prediction models and a second dataset from Romania containing more than 15,000 car quotes used mainly to observe local traits. As such, we include extensive cross-market analyses by comparing the emerging Romanian market versus one of the world’s largest and most developed car markets, Germany. Our study uses several neural network architectures that capture complex relationships between car model features, individual add-ons, and visual features to predict used car prices accurately. Our models achieved a high R2 score exceeding 0.95 on both datasets, indicating their effectiveness in estimating used car prices. Moreover, we experimented with advanced convolutional architectures to predict car prices based solely on visual features extracted from car images. This approach exhibited transfer-learning capabilities, leading to improved prediction accuracy, especially since the Romanian training dataset is limited. Our experiments highlight the most important factors influencing the price, while our findings have practical implications for buyers and sellers in assessing the value of vehicles. At the same time, the insights gained from this study enable informed decision-making and provide valuable guidance in the used car market.

Badminton tactics refer to the techniques and strategies employed by players to win a match. Analyzing these tactics can help players improve their performance and outsmart their opponents. To study the tactics of top players, we use a gaming tree to analyze matches between two of the most powerful badminton players in history: Lin and Lee. By employing the Nash Equilibrium, we can discover the most beneficial strategies for both players, which reflect their most powerful techniques. Additionally, with the help of this gaming tree, we can precisely predict how players will implement their tactics. Empirical experimental results demonstrate that our proposed method not only evaluates and identifies each player's weaknesses and strengths but also has powerful capabilities to predict their tactics.

Currently, the district heating (DH) in Poland is facing many challenges. The business model used hitherto was very simple—in most cities, heating plants produced heat, and centralized heating systems supplied the "product" at a price approved annually by the president of the Energy Regulatory Office (URE). However, recent years have brought significant changes on the market. EU regulations force the elimination of old coal-fired plants that were still built in the Polish People's Republic (PRL), moreover, high prices of CO2 emission allowances aggravate the financial situation of companies. In addition, in the heating sector, the trend observed in the power sector is becoming increasingly visible—limiting the role of large sources in favor of energy generated locally, closer to the customer. One of the biggest challenges is achieving the targets set by the EU for the share of renewable energy sources (RES) in the heating sector. The war in Ukraine and problems with the supply of coal and gas are an additional impulse to turn to RES. Thus, the development of sustainable and innovative solutions for energy production and supply at the level of urban networks is currently one of the main technical challenges. The purpose of the paper is to present the current situation and perspectives of development of district heating systems in Poland with a view to the status of district heating in the world, and some deeper insight into European conditions. The review presents energy sources with particular emphasis on renewable energy sources (RES) and their cogeneration for heat production. The examples of existing heating network solutions using renewable energy sources, based on the selected published case studies, are also discussed.

Infrared dim and small target detection is a key technology of various detection tasks. However, due to the lack of shape, texture, and other information, it is a challenging task to detect dim and small targets. Recently, since many traditional algorithms ingore global information of infrared images, they generate some false alarms in complicated environments. To address this problem, in this paper, a coarse-to-fine deep learning-based method is proposed to detect dim and small targets. Firstly, a coarse-to-fine detection framework integrating deep learning and background prediction is applied for detecting targets. The framework contains of coarse detection module and fine detection module. In coarse detection stage, Region Proposal Network (RPN) is employed to generate masks in target candidate regions. Then, for further optimize the result, inpainting is utilized to predict the background by the global semnantic of images. In this paper, inpainting algorithm with a mask aware dynamic filtering module is incorporated into the fine detection stage to estimate background in candidate target areas. Finally, compared with existing algorithms, the experimental results indicate that the proposed framework have effective detection capability and robustness for complex surroundings.

The object detection task is usually affected by complex backgrounds. In this paper, a new image object detection method is proposed, which can perform multi-feature selection on multi-scale feature maps. By this method, a bidirectional multi-scale feature fusion network is designed to fuse semantic features and shallow features to improve the detection effect of small objects in complex backgrounds. When the shallow features are transferred to the top layer, a bottom-up path is added to reduce the number of network layers experienced by the feature fusion network, reducing the loss of shallow features. In addition, a multi-feature selection module based on the attention mechanism is used to minimize the interference of useless information on subsequent classification and regression, allowing the network to adaptively focus on appropriate information for classification or regression to improve detection accuracy. Because the traditional five-parameter regression method has severe boundary problems when predicting objects with large aspect ratios, the proposed network treats angle prediction as a classification task. The experimental results on the DOTA dataset, the self-made DOTA-GF dataset and the HRSC 2016 dataset show that, compared with several popular object detection algorithms, the proposed method has certain advantages in detection accuracy.

This paper presents an effective heart disease prediction model through detecting the anomalies, also known as outliers, in healthcare data using the unsupervised K-means clustering algorithm. Most existing approaches for detecting anomalies are based on constructing profiles of normal instances. However, such techniques require an adequate number of normal profiles to justify those models. Our proposed model first evaluates an \textit{optimal} value of K using Silhouette method. Next, it intends to locate anomalies that are far from a certain threshold distance with respect to their clusters. Finally, the five most popular classification techniques such as K-Nearest Neighbor (KNN), Random Forest (RF), Support Vector Machines (SVM), Naive Bayes (NB), and Logistic Regression (LR) are applied to build the resultant prediction model. The effectiveness of the proposed methodology is justified using a benchmark dataset of heart disease.

In this paper we propose the generation of synthetic small and more sophisticated molecule structures that optimize the binding affinity to a target (ASYNT-GAN). To achieve this we leverage on three important achievements in A.I.: Attention, Deep Learning on Graphs and Generative Adversarial Networks. Similar to text generation based on parts of text we are able to generate a molecule architecture based on an existing target. By adopting this approach, we propose a novel way of searching for existing compounds that are suitable candidates. Similar to question and answer Natural Language solutions we are able to find drugs with highest relevance to a target. We are able to identify substructures of the molecular structure that are the most suitable for binding. In addition, we are proposing a novel way of generating the molecule in 3D space in such a way that the binding is optimized. We show that we are able to generate compound structures and protein structures that are optimised for binding to a target.

In order to design efficient and sustainable office spaces and to automate lighting, heating and air circulation in these facilities, solving the challenge of occupancy prediction is crucial. In office spaces where large areas need to be observed, multiple sensors must be used for full coverage. In these cases, it is normally important to keep the costs low, but also to make sure that the privacy of the people who use such environments are preserved. Low-cost and low-resolution heat (thermal) sensors can be very useful to build solutions that address these concerns. However, they are extremely sensitive to noise artifacts which might be caused by heat prints of the people who left the space or by other objects which are either using electricity or exposed to sunlight. There are some earlier solutions for occupancy prediction that employ low-resolution heat sensors, however, they have not addressed nor compensate for such heat artifacts. Therefore, in this paper, we present a low-cost and low-energy consuming smart space implementation to predict the number of people in the environment based on whether their activity is static or dynamic in time. We use a low-resolution (8×8) and non-intrusive heat sensor to collect data from an actual meeting room. We propose two novel workflows to predict the occupancy; one based on computer vision and one based on machine learning. Besides comparing the advantages and disadvantages of these different workflows, we use several state-of-the-art explainability methods in order to provide a detailed analysis of the algorithm parameters and how the image properties influence the resulting performance. Furthermore, we analyze noise resources which affect the heat sensor data. We hope that our analysis brings light into understanding how to handle very low-resolution heat images in these environments. The presented workflows could be used in various domains and applications other than smart offices, where occupancy prediction is essential, e.g., for elderly care.

In this work we present the results obtained with an artificial neural network (ANN) which we trained to predict the expected output of high-order harmonic generation (HHG) process, while exploring a multi-dimensional parameter space. We argue on the utility and efficiency of the ANN model and demonstrate its ability to predict the outcome of HHG simulations. In this case study we present the results for a loose focusing HHG beamline, where the changing parameters are: the laser pulse energy, gas pressure, gas cell position relative to focus and gas cell length. The physical quantity which we predict here using ANN is directly related to the total harmonic yield in a specified spectral domain (20-40 eV). We discuss the versatility and adaptability of the presented method.

The Sugarcane yellow leaf virus (SCYLV) is associated with sugarcane yellow leaf disease (SCYLD) and is considered to be the most economically deleterious emerging pathogen that represents a potential threat and danger to sugarcane cultivation in China. Over the last two decades, high genetic diversity in the SCYLV genotypes was observed worldwide, with a greater chance of YLD incidence for sugarcane injury. SCYLV infection has significantly damaged its economic traits and is responsible for substantial losses in biomass production in sugarcane cultivars. This study aims to identify and comprehensively analyze sugarcane microRNAs (miRNAs) as therapeutic targets against SCYLV using plant miRNA prediction tools. Mature sugarcane miRNAs are retrieved and are used for hybridization of the SCYLV. A total of seven common sugarcane miRNAs were selected based on consensus genomic positions. The biologically significant, top ranked ssp-miR528 was consensually predicted to have a potentially unique hybridization site at nucleotide position 4162 for targeting the ORF5 of the SCYLV genome; this was predicted by all the algorithms used in this study. Then, the miRNA–mRNA regulatory network was generated using the Circos algorithm, which was used to predict novel targets. There are no acceptable commercial SCYLV-resistant sugarcane varieties available at present. Therefore, the predicted biological data offer valuable evidence for the generation of SCYLV-resistant sugarcane plants.

In crystal structure prediction, Newton's second law can always be applied to particles (atoms or ions) in a cell to determine their positions. However the values of the period vectors (crystal cell edge vectors) should be determined as well. Here we applied the dynamical equations of period vectors derived recently based on Newton's laws (doi:/10.1139/cjp-2014-0518) for that purpose, where the period vectors are driven by the imbalance between the internal and external pressures/stresses. For equilibrium states, they became equations of state, which essentially turn out the equilibrium conditions of crystals from mechanical point of view. For external pressure, by ignoring some effects, they reduced to the Mie-Gruneisen equation. Since the internal stress has both a full kinetic energy term and a full interaction term, the influences of both external temperature and stress/pressure on crystal structures can be calculated, then thermodynamical properties and processes were presented. Contrary to usual ideas, the equations show that pure harmonic vibrating phonons can result in thermal expansion in crystals when the external temperature is changed. Finally, crystal system collapse due to temperature and/or stress/pressure change was discussed.

Cotton leaf curl Kokhran virus (CLCuKoV) (genus, Begomovirus; family, Geminiviridae) is highly infectious, widespread and the most dangerous pathogen of cotton (Gossypium hirsutum L.) that is responsible to a serious disorder, cotton leaf curl disease (CLCuD). Begomoviruses are spread very efficiently by the whitefly Bemisia tabaci cryptic species, causing economic losses to cotton crop, all over the world. The ‘Lucknow’ strain of CLCuKoV has emerged as a divergent isolate that could cause CLCuD. The monopartite ssDNA genome of CLCuKoV-Lu (2.7 Kb) contains six open reading frames (ORFs) that was shown to encode four major proteins. RNA interference (RNAi)-based antiviral innate immunity is a sequence-specific biological phenomenon and a powerful tool to control plant viruses. The present study aims to determine cotton locus-derived microRNAs (ghr-miRNAs) that are identified for targeting the CLCuKoV-Lu ss-DNA-encoded mRNAs using a predictive approach that involves four computational algorithms, miRanda, RNA22, psRNATarget and RNAhybrid. Mature ghr-miRNA sequences (n=80) from allotetraploid upland cotton (2n = 4x = 52) were selected from the miRBase and were tested for alignment with the CLCuKoV-Lu genome. Among the 80 cotton locus-derived ghr-miRNAs evaluated, only one consensus cotton locus-derived ghr-miRNA (ghr-miR2950) was concluded to have effective ghr-miRNA target site at common nucleotide position 82 in the CLCuKoV-Lu genome respectively, using a stringent criterion, identified by all the algorithms used. The miRNA targeting is reliant on base pairing of miRNA-mRNA target pairings. Conservation of the hybridization binding site of the predicted ghr-miR2950 was validated using multiple sequence alignment within all the strains of CLCuKoV. We constructed a regulatory interaction network of miRNA–mRNA to identify novel targets. The efficacy of the predicted miRNAs against CLCuKoV-Lu was evaluated by RNAi-mediated targeted mRNA cleavage. The current investigated miRNA targets provide evidence for the development of CLCuD-resistant cotton plants.

Oral and parenteral delivery of first-line anticonvulsant Valproic cid (VA) are associated with serious adverse effects, high hepatic metabolism, high clearance, and low bioavailability in brain. GastroPlus program was used to predict in vivo performance of immediate (IR) and sustained release (SR) products in human. HSPiP software predicted excipients with maximum possible miscibility of the drug. Based on GastroPlus and HSPiP program, various excipients were screened for experimental solubility study and prepared cationic nanoemulsions and respective gels for nasal to brain delivery. These were characterised for size, size distribution, polydispersity index, zeta potential, morphology, pH, % transmittance, drug content, and viscosity. In vitro drug release, ex vivo permeation profile (goat nasal mucosa), and penetration studies were conducted. Result showed that in-vivo oral drug dissolution and absorption were predicted as 98.6 mg and 18.8 mg, respectively from both tablets (IR and SR) at 8 h using GastroPlus. The drug access to the portal vein was relatively predicted high in IR (115 mg) as compared to SR (82.6 mg). Plasma drug concentration-time profile predicted was in good agreement with published reports. The program predicted duodenum and jejunum as the prime site of drug absorption and no effect of nanonization on Tmax for sustained release formulation. Hansen parameters suggested suitable selection of excipients. The program recommended for nasal to brain delivery of the drug using cationic mucoadhesive product. The optimized stable CVE6 was associated with optimal size (113 nm), low PDI (0.26), high zeta potential (+34.7 mV), high transmittance (97.8%), and high strength (0.7 %w/w). In vitro release and ex vivo permeation of CVE6 were found to be substantially high as compared to anionic AVE6 and respective gels. Penetration study executed high fluorescence intensity with CVE6 and CVE6-gel as compared to suspension and ANE6 which may be attributed to electrostatic interaction between mucosal membrane and nanoglobules. Thus, cationic nanoemulsion and respective mucoadhesive gel are promising strategy for delivery of VA to brain through intransal administration for the treatment of seizure and convulsion.

Large lithium-ion batteries (LIBs) in electric vehicles and energy storage systems demonstrate different performance and lifetime compared to small LIB cells, owing to the size effects generated by the electrical configuration and property imbalance. However, the calculation time for performing life predictions with three-dimensional (3D) cell models is undesirably long. In this paper, a lumped cell model with equivalent resistances (LER cell model) is proposed as a reduced order model of the 3D cell model, which enables accurate and fast life predictions of large LIBs. The developed LER cell model is validated via the comparisons with results of the 3D cell models by simulating a 20-Ah commercial pouch cell (NCM/graphite) and the experimental values. In addition, the LER cell models are applied to different cell types and sizes, such as a 20-Ah cylindrical cell and a 60-Ah pouch cell.

The synthesis and characterization of the multicomponent crystals formed by 2,2’-thiodiacetic acid (H2tda) and 2,6-diaminopurine (Hdap) or N9-(2-hydroxyethyl)adenine (9heade) are reported. The crystals are in the salt rather than cocrystal form, as witnessed by single crystal X-ray diffractometry where a structural analysis revealed their ionic nature, confirming the proton transfer from the 2,2’-thiodiacetic acid to the basic groups of the coformers. The new multicomponent crystals have molecular formulas [(H9heade+)(Htda)] (1) and [(H2dap+)2(tda2)]·2H2O (2), and were also characterized by FTIR, elemental analysis as well as thermogravimetric/differential scanning calorimetry (TG/DSC) analyses. In the crystal packing the ions interact with each other via O–H···N, O–H···O. N–H···O and N–H···N hydrogen bonds generating cyclic hydrogen bonded motifs with graph-set notation of R22(16), R22(10), R32(10), R33(10), R22(9), R32(8) and R42(8), to form different supramolecular homo- and hetero-synthons. In addition, in the crystal packing of 2, pairs of diaminopurinium ions display an strong anti-parallel ,-stacking interaction, with short inter-centroids and interplanar distances (3.39 and 3.24 Å respectively) and fairly tight angle (17.5°). These assemblies have been further analyzed energetically by using DFT calculations, MEP surface analysis and QTAIM characterization.

Abstract: In recent years, the construction engineering sector has undergone a transformative shift towards the integration of machine learning (ML) techniques, particularly in predicting the properties of steel fiber-reinforced concrete (SFRC). Despite the theoretical sophistication of existing models, a persistent challenge remains – their opacity, lacking transparency and real-world relevance for practi-tioners. To address this gap and advance our current understanding, this study employs the extra gradient (XG) Boosting algorithm, crafting a comprehensive ap-proach. Grounded in a meticulously curated database drawn from 43 seminal pub-lications, encompassing 420 distinct records, this research focuses predominantly on three primary fiber types: crimped, hooked, and mil-cut. Complemented by hands-on experimentation involving 20 diverse SFRC mixtures, this empirical campaign is further illuminated through the strategic use of Partial Dependence Plots (PDPs), revealing intricate relationships between input parameters and con-sequent compressive strength. A pivotal revelation of this research lies in the identification of optimal SFRC formulations, offering tangible insights for real-world applications. The developed ML model stands out not only for its sophistication but also its tangible accuracy, evidenced by exemplary performance against inde-pendent datasets, boasting a commendable mean target-prediction ratio of 99%. To bridge the theory-practice gap, we introduce a user-friendly digital interface, thri-ughly designed to guide professionals in optimizing and accurately predicting the compressive strength of SFRC. This research thus contributes to the construction and civil engineering sectors by enhancing predictive capabilities and refining mix designs, fostering innovation, and addressing the evolving needs of the industry.

An accurate outbreak prediction of COVID-19 can successfully help to get insight into the spread and consequences of infectious diseases. Recently, machine learning (ML) based prediction models have been successfully employed for the prediction of the disease outbreak. The present study aimed to engage an artificial neural network-integrated by grey wolf optimizer for COVID-19 outbreak predictions by employing the Global dataset. Training and testing processes have been performed by time-series data related to January 22 to September 15, 2020 and validation has been performed by time-series data related to September 16 to October 15, 2020. Results have been evaluated by employing mean absolute percentage error (MAPE) and correlation coefficient (r) values. ANN-GWO provided a MAPE of 6.23, 13.15 and 11.4% for training, testing and validating phases, respectively. According to the results, the developed model could successfully cope with the prediction task.

The deformation monitoring information of concrete dams contains some high-frequency com-ponents, and the high-frequency components are strongly nonlinear, which reduces the accuracy of dam deformation prediction. In order to solve such problems, this paper proposes a concrete dam deformation monitoring model based on empirical mode decomposition (EMD) combined with wavelet threshold noise reduction and sparrow search algorithm (SSA) optimization of long short-term memory network (LSTM). The model uses EMD combined with wavelet threshold to decompose and denoise the measured deformation data. On this basis, the LSTM model based on SSA optimization is used to mine the nonlinear function relationship between the reconstructed monitoring data and various influencing factors. The example analysis shows that the model has good calculation speed, fitting and prediction accuracy and it can effectively mine the date char-acteristics inherent in the measured deformation, and reduce the influence of noise components on the modeling accuracy.

Electricity demand prediction is vital for energy production management and proper exploitation of the present resources. Recently, several novel machine learning (ML) models have been employed for electricity demand prediction to estimate the future prospects of the energy requirements. The main objective of this study is to review the various ML models applied for electricity demand prediction. Through a novel search and taxonomy, the most relevant original research articles in the field are identified and further classified according to the ML modeling technique, perdition type, and the application area. A comprehensive review of the literature identifies the major ML models, their applications and a discussion on the evaluation of their performance. This paper further makes a discussion on the trend and the performance of the ML models. As the result, this research reports an outstanding rise in the accuracy, robustness, precision and the generalization ability of the prediction models using the hybrid and ensemble ML algorithms.

Transcriptional regulations have been widely studied as one of the main bridges between biology and other basic sciences as well as medicine. The traffic across it has been mostly unidirectional: chemistry and physics provided a lot of tools for biology, although the supply is now saturating. The traffic in opposite direction, the supply of subjects to develop chemistry and physics, has been only a little. However, if there are any, the supply will be at least from transcription, because the notion of chemical reaction is the strongest. This topic is aimed to increase the opposite traffic by introducing the forefront of physicochemical studies of transcription.

Accurate and stable cost forecasting of substation projects is of great significance to ensure the economic construction and sustainable operation of power engineering projects. In this paper, a forecasting model based on the improved least squares support vector machine (ILSSVM) optimized by wolf pack algorithm(WPA) is proposed to improve the accuracy and stability of the cost forecasting of substation projects. Firstly, the optimal features are selected through the data inconsistency rate (DIR), which helps reduce redundant input vectors. Secondly, the wolf pack algorithm is used to optimize the parameters of the improved least square support vector machine. Lastly, the cost forecasting method of WPA-DIR-ILSSVM is established. In this paper, 88 substation projects in different regions from 2015 to 2017 are chosen to conduct the training tests to verify the validity of the model. The results indicate that the new hybrid WPA-DIR-ILSSVM model presents better accuracy, robustness and generality in cost forecasting of substation projects.

Efficient triaging and referral assessment are critical in ensuring prompt medical intervention in the Community Health Care (CHC) system. However, the existing triaging systems in many Community Health Services are an intensive, time-consuming process and often lack accuracy, particularly for various symptoms that might represent heart failure or other health-threatening conditions. There is a noticeable limit of research papers describing AI technologies for triaging patients. This paper proposes a novel quantitative data-driven approach using machine learning (ML) modelling to improve the community clinical triaging process. Furthermore, this study aims to employ the feature selection process and machine learning power to reduce the triaging process’s waiting time and increase accuracy in clinical decision-making. The model was trained on medical records of “Heart Failure” patients’ dataset, which included demographics, past medical history, vital signs, medications, and clinical symptoms. A comparative study was conducted using the list of machine learning algorithms where XGBoost demonstrated the best performance among other ML models. The triage levels of 2,35,982 patients achieved an accuracy of 99.94%, precision of 0.9986, recall of 0.9958, and f1-score of 0.9972 within 0.059 seconds. The proposed diagnostic model can be implemented for the CHC decision system and be developed further for other medical conditions.

Background: In today’s competitive market, predicting customer churn with high accuracy is crucial for enterprises to maintain growth and profitability. Traditional predictive models often lack in accuracy due to the complexity of customer behavior.Objective: This research aims to improve the accuracy of predicting customer churn by utilizing the Particle Swarm Optimization (PSO) algorithm for optimizing the hyperparameters of a composite deep learning model. The performance of this enhanced model is evaluated against traditional models such as LSRM_GRU, LSTM, GRU, and CNN_LSTM to demonstrate the effectiveness of PSO in hyperparameter tuning.Methods: A composite deep learning approach was employed, integrating various neural network architectures to leverage their strengths in modeling complex customer interactions. The PSO algorithm was used to optimize the model’s hyperparameters. Customer transaction and interaction data from different business operations served as the dataset for testing and analyzing the model’s performance. Evaluation metrics including accuracy, precision, recall, F1 score, and ROC AUC were utilized for a detailed comparison with established models.Findings: The PSO-enhanced composite deep learning model showed superior performance across all metrics, significantly outperforming the LSRM_GRU, LSTM, GRU, and CNN_LSTM models. Notably, improvements in ROC AUC and F1 score highlight the robustness and balanced precision-recall trade-off of the proposed model, demonstrating its effectiveness in identifying potential churners.Conclusion: The integration of PSO for hyperparameter optimization in composite deep learning models for customer churn prediction has proven to significantly enhance predictive accuracy and performance metrics over conventional models. This underscores the potential of evolutionary algorithms in improving deep learning applications. Future research should explore the scalability of this approach across various sectors and further refine predictive accuracy with evolving customer data.

Crop digital twin is redefining traditional farming practices, offering unprecedented opportunities for real-time monitoring, predictive and simulation analysis, and optimization. This research embarks on an exploration of the synergy between precision agriculture, crop modeling, and regression algorithms to create a digital twin for augmenting farmers the concentration and composition prediction-based crop nutrient recovery. This captures the holistic representation of crop characteristics, considering the intricate relationships between environmental factors, nutrient concentrations, and crop compositions. However, the complexity arising from diverse soil and environmental conditions makes nutrient content analysis expensive and time-consuming. This paper presents the result of a predictive digital twin case study that employs six regression algorithms namely Elastic Net, Polynomial, Stepwise, Ridge, Lasso, and Linear Regression to predict rice nutrient content efficiently, particularly considering the coexistence and composition of multiple nutrients. Our research findings highlight the superiority of the Polynomial Regression model in predicting nutrient content, with a specific focus on accurate nitrogen percentage prediction. This insight can be used for nutrient recovery intervention by knowing the precise amount of nutrient to be added into the crop medium. The adoption of the Polynomial Regression model offers a valuable tool for nutrient management practices in the crop digital twin, potentially resulting in higher-quality rice production and a reduced environmental impact. The proposed method can be replicable in other low-resourced crop digital twin system.

Tripping is the largest cause of falls and low swing foot ground clearance during the mid-swing phase, particularly at the critical gait event known as Minimum Foot Clearance (MFC) is the major risk factor for tripping-related falls. Intervention strategies to increase MFC height can be effective if applied in real-time based on feed-forward prediction. The current study investigated the capability of machine learning models to classify the MFC into various categories using toe-off kinematics data. Specifically, three MFC sub-categories (less than 1.5cm, between 1.5-2.0cm and higher than 2.0cm) were predicted applying machine learning approaches. A total of 18,490 swing phase gait cycles’ data were extracted from six healthy young adults, each walking for 5-minutes at a constant speed of 4km/h on a motorised treadmill. Both K-Nearest Neighbour (KNN) and Random-Forest were utilised for prediction based on the data from toe-off for five consecutive frames (0.025s duration). Foot kinematics data were obtained from inertial measurement unit attached to the mid-foot, recording tri-axial linear accelerations and angular velocities of the local coordinate. KNN and Random-Forest achieved 84% and 86% accuracy, respectively, in classifying MFC into the three sub-categories with run time of 0.39 seconds and 13.98 seconds respectively. The KNN-based model was found to be more effective if incorporated into an active exoskeleton as the intelligent system to control MFC based on the preceding gait event, toe-off due to its quicker computation time. The machine learning based prediction model shows promise for the prediction of critical MFC data indicating higher tripping risk.

The purpose of this work is to compare two fracture prediction models with real-world data. The pure Artificial Neural Network (ANN) model emphasizes regression analysis, while the hybrid model (SVM-ANN) focuses on the combination of regression and classification analysis or Support Vector Machine. The results were subsequently tested against logging data by combining the Machine Learning approach with advanced logging tools. In this context, we used electrical image logs and the dipole acoustic tool which together allowed the distinction of 404 open fractures and 231 closed fractures and, consequently the estimation of fracture porosity. The results are then fed into two machine-learning algorithms. Pure Artificial Neural Networks and hybrid models are used to establish comprehensive results, which are subsequently tested to check the accuracy of the models. The outputs obtained from the two methods demonstrate that the hybridized model has a lower Root Mean Square Error (RMSE) than pure ANN. The results of our approach strongly suggest that incorporating hybridized machine learning algorithms in fracture porosity estimations can contribute to the development of more trustworthy static reservoir models in simulation programs. Finally, the combination of Machine Learning (ML) and well-log analysis do permit reliable estimation of fracture porosity in the Ahnet field in Algeria, where, in many places, advanced logging data is absent and costly.

In recent years, intelligent identification and prediction of ore deposits based on deep learning algorithm and image processing technology has gradually become one of the research frontiers in the field of geological and metallogenic prediction. However, this method also has many problems that need to be solved. For example, (1) very few trainable image samples containing mineral point labels; (2) The geological image features are small and irregular, and the image similarity is high; (3) It is difficult to calculate the influence of different geological prospecting factors on ore mineralization. Based on this, this paper constructs a deep learning network model Multiscale Feature Attention Framework (MFAF) based on geo-image data. The results show that MFCA-Net module in MFAF model can solve the problem of scarce mine label images to a certain extent. In addition, the channel attention mechanism SE-Net module can quantify the difference of influence of different source factors on mineralization. The prediction map is obtained by applying the MFAF model in the study of deposit identification and prediction in the research area of the southern section of Qin-hang metallogenic Belt. In the forecast map, many regions have high metallogenic potential. Through observation, it is found that the above predicted area covers 100% of the known ore deposits at present, which has a good prediction effect. Later, we can find out the specific reasons through field verification. The multi-scale feature fusion and attention mechanism MFA Framework in this paper can provide a new way of thinking for geologists in mineral exploration. The research of this paper also provides resource guarantee and technical support for the sustainable exploitation of mineral resources and the sustainable growth of society and economy.

Nowadays, there is extensive production and use of plastic materials for different industrial activities. These plastics, either from their primary production sources or through degradation processes of the plastics themselves, can contaminate the ecosystem with micro and nanoplastics. Once in the aquatic environment, these microplastics can be the basis for the adsorption of chemical pollutants, favoring that these chemical pollutants disperse more quickly in the environment and can affect living beings. Due to the lack of information on adsorption, three machine learning models (random forest, support vector machine, and artificial neural network) to predict different microplastic/water partition coefficients (log Kd) were developed using two different approximations (based on the number of input variables). The best-selected machine learning models present, in general, correlation coefficients upper than 0.92 in the query phase, which indicate that these type of models could be used for a rapid estimation of the absorption of organic contaminants on microplastics.

The passenger prediction flow is very significant to transportation sustainability. This is due to some chaos of traffic jams encountered by the road users during their movement to the offices, schools, or markets at earlier of the days and during closing periods. This problem is peculiar to the transportation system of the Federal University of Technology Minna, Nigeria. However, the prevailing technique of passenger flow estimation is non-parametric which depends on the fixed planning and is easily affected by noise. In this research, we proposed the development of a hybrid intelligent passenger frequency prediction model using the Auto-Regressive Integrated Moving Average (ARIMA) linear model, Convolutional Neural Network (CNN), and Kalman Filter Algorithm (KFA). The passengers’ frequency of arrival at the bus terminals is obtained and enumerated through the closed-circuit television (CCTV) and demonstrated using the Markovian Queueing Systems Model (MQSM). The ARIMA model was used for learning and prediction and compared the result with the combined techniques of using CNN-KFA. The autocorrelation coefficient functions (ACF) and partial autocorrelation coefficient functions (PACF) are used to examine the stationary data with different features. The performance of the models was analyzed and evaluated in describing the short-term passenger flow frequency at each terminal using the Mean Absolute Percentage Error (MAPE) and Mean Squared Error (MSE) values. The CNN-Kalman-filter model was fitted into the short-term series and the MAPE values are below 10%. The Mean Square Error (MSE) shows that the CNN-Kalman Filter model has the overall best performance with 83.33% of the time better than the ARIMA model and provides high accuracy in forecasting.

A time integration scheme based on semi-Lagrangian advection and Laplace transform adjustment has been implemented in a baroclinic primitive equation model. The semi-Lagrangian scheme makes it possible to use large time steps. However, errors arising from the semi-implicit scheme increase with the time step size. In contrast, the errors using the Laplace transform adjustment remain relatively small for typical time steps used with semi-Lagrangian advection. Numerical experiments confirm the superior performance of the Laplace transform scheme relative to the semi-implicit reference model. The algorithmic complexity of the scheme is comparable to the reference model, making it computationally competitive, and indicating its potential for integrating weather and climate prediction models.