The Sugarcane yellow leaf virus (SCYLV) is associated with sugarcane yellow leaf disease (SCYLD) and is considered to be the most economically deleterious emerging pathogen that represents a potential threat and danger to sugarcane cultivation in China. Over the last two decades, high genetic diversity in the SCYLV genotypes was observed worldwide, with a greater chance of YLD incidence for sugarcane injury. SCYLV infection has significantly damaged its economic traits and is responsible for substantial losses in biomass production in sugarcane cultivars. This study aims to identify and comprehensively analyze sugarcane microRNAs (miRNAs) as therapeutic targets against SCYLV using plant miRNA prediction tools. Mature sugarcane miRNAs are retrieved and are used for hybridization of the SCYLV. A total of seven common sugarcane miRNAs were selected based on consensus genomic positions. The biologically significant, top ranked ssp-miR528 was consensually predicted to have a potentially unique hybridization site at nucleotide position 4162 for targeting the ORF5 of the SCYLV genome; this was predicted by all the algorithms used in this study. Then, the miRNA–mRNA regulatory network was generated using the Circos algorithm, which was used to predict novel targets. There are no acceptable commercial SCYLV-resistant sugarcane varieties available at present. Therefore, the predicted biological data offer valuable evidence for the generation of SCYLV-resistant sugarcane plants.

Corona viruses hijack human enzymes to assembly sugar coat on Spike glycoproteins. The mechanism that human antibodies may uncover the antigenic viral peptide epitopes hidden by sugar coat are unknown. In this study, we analyzed recombinant SARS-CoV-2 Spike protein secreted from BTI-Tn-5B1-4 cells, by trypsin and chymotrypsin digestion followed by mass spectrometry analysis. We acquired MS/MS spectrums for glycopeptides of all 22 predicted N-glycosylated sites. We further analyzed the surface accessibility of Spike proteins according to Cryo-EM and homolog-modeled structures, and available antibodies that bind to SARS-CoV-1. The results showed that all 22 N-glycosylated sites of SARS-CoV-2 are modified by high-mannose type of N-glycans. MS/MS fragmentation clearly established the glycopeptide identities. Electron densities of glycans cover most of the Spike receptor binding domain of SARS-CoV-2, except YQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQ, similar to a region FSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQ in SARS-CoV-1. Other surface-exposed domains included those located on Central Helix, between amino acids 967 and 1016 of SARS-CoV-1, and 985 to 1034 of SARS-CoV-2 Spike protein. As the majority of antibody paratopes bind to peptide portion with or without sugar modification, we propose a snake-catcher model that a minimal length of peptide is first clamped by a paratope, and the binding is either strengthened by sugars close to peptide, or not interfered by sugar modification.

Software fault prediction is the very consequent research topic for software quality assurance. Data driven approaches provide robust mechanisms to deal with software fault prediction. However, the prediction performance of the model highly depends on the quality of dataset. Many software datasets suffers from the problem of class imbalance. In this regard, under-sampling is a popular data pre-processing method in dealing with class imbalance problem, Easy Ensemble (EE) present a robust approach to achieve a high classification rate and address the biasness towards majority class samples. However, imbalance class is not the only issue that harms performance of classifiers. Some noisy examples and irrelevant features may additionally reduce the rate of predictive accuracy of the classifier. In this paper, we proposed two-stage data pre-processing which incorporates feature selection and a new Rough set Easy Ensemble scheme. In feature selection stage, we eliminate the irrelevant features by feature ranking algorithm. In the second stage of a new Rough set Easy Ensemble by incorporating Rough K nearest neighbor rule filter (RK) afore executing Easy Ensemble (EE), named RKEE for short. RK can remove noisy examples from both minority and majority class. Experimental evaluation on real-world software projects, such as NASA and Eclipse dataset, is performed in order to demonstrate the effectiveness of our proposed approach. Furthermore, this paper comprehensively investigates the influencing factor in our approach. Such as, the impact of Rough set theory on noise-filter, the relationship between model performance and imbalance ratio etc. comprehensive experiments indicate that the proposed approach shows outstanding performance with significance in terms of area-under-the-curve (AUC).

Cold-water coral reefs are rich, yet fragile ecosystems found in colder oceanic waters. Knowledge of their spatial distribution on continental shelves, slopes, seamounts and ridge systems is vital for marine spatial planning and conservation. Cold-water corals frequently form conspicuous carbonate mounds of varying sizes, which are identifiable from multibeam echosounder bathymetry and derived geomorphometric attributes. However, the often large number of mounds makes manual interpretation and mapping a tedious process. We present a methodology that combines image segmentation and random forest spatial prediction with the aim to derive maps of carbonate mounds and an associated measure of confidence. We demonstrate our method based on multibeam echosounder data from Iverryggen on the mid-Norwegian shelf. We identified the image-object mean planar curvature as the most important predictor. The presence and absence of carbonate mounds is mapped with high accuracy (overall accuracy = 84.4%, sensitivity = 0.827 and specificity = 0.866). Spatially-explicit confidence in the predictions is derived from the predicted probability and whether the predictions are within or outside the modelled range of values and is generally high. We plan to apply the showcased method to other areas of the Norwegian continental shelf and slope where MBES data have been collected with the aim to provide crucial information for marine spatial planning.

The philosophy of testing statistical hypothesis is a natural consequence and functional extension of mathematical analysis of Probability. Along with the concept of recurrence when applied to random sequences and functions, it leads to the analysis of a priori and posterior which implies testing statistical hypothesis. Testing statistical hypothesis also involves algebraic, functional and dimensional considerations, which are found in the works of Laplace. Aspects of mathematical analysis such as universality of solutions, Laws of Large Numbers, Entropy, Information, and various functional dependencies are the main factors explained in the five properties that lead to implication of testing statistical hypothesis. Various interesting examples with modern scientific significance from genetics, astrophysics, and other areas give methodological access to answers of different problems and phenomena which are involved in the logic of testing statistical hypothesis.

This paper focuses on enhancing the object detection and decision-making capabilities of Autonomous Emergency Medical Response Systems (AEMRS). Using advanced sensors, Convolutional Neural Networks (CNN), and reinforcement learning, we propose a model that processes environmental data to identify obstacles and make optimal navigation decisions. The integration of these technologies aims to minimize response time and improve the efficiency of emergency medical services. The perception system utilizes radar, LiDAR, and camera inputs to create a comprehensive understanding of the environment. These data are processed through a series of CNN layers to detect and classify objects such as vehicles, pedestrians, and road signs. On the decision-making front, a Q-learning algorithm is employed to enable the ambulance to learn from its interactions with the environment, continuously improving its route planning and collision avoidance strategies. By combining these advanced AI techniques, the proposed AEMRS can significantly enhance the speed and reliability of emergency responses, ultimately saving more lives. This paper presents the design, implementation, and simulation results of the proposed system, demonstrating its potential to revolutionize emergency medical services.

This study empirically analyzes the effectiveness of resource optimization utilizing artificial intelligence (AI) within cloud computing environments. It compares systems that have been transitioned from a Monolithic structure to Microservices Architecture (MSA) with those adopting a simple Rehost strategy, to validate the operational efficiency of two systems whose resource efficiency has been enhanced compared to traditional legacy systems. The research is based on systems that determined resource efficiency post-cloud migration using APM tools. It points out the limitations of traditional heuristic operation methods in resource optimization, which lead to issues such as application performance degradation, resource over-allocation, and increased operational costs. This study aims to overcome the conventional resource optimization standards that depended on the average peak usage of CPU and memory infrastructure, by introducing AI-based optimization tools, and applying on-premise standards to cloud and container environments to achieve resource optimization. The paper emphasizes the importance of resource optimization through AI-based automation tools, exploring the possibilities of resolving real-world application performance issues in cloud environments, reducing unnecessary resource usage costs, and cutting down on labor risks and operational expenses. Through this, it presents strategic directions on how AI technology can offer financial and operational advantages in managing cloud resources.

The relationship between pangolin-CoV and SARS-CoV-2 has been a subject of debate. Further evidence of a special relationship between the two viruses can be found by the fact that all known COVID-19 viruses have abnormally hard outer shell (low M disorder; i.e., low content of intrinsically disordered residues in the membrane (M) protein) that so far was found in CoVs associated with burrowing animals, such as rabbits and pangolins, in which transmission involves virus remaining in buried feces for a long time. While a hard outer shell is necessary for viral survival, a harder inner shell could also help. For this reason, the N disorder range of pangolin-CoVs, not bat-CoVs, more closely matches that of SARS-CoV-2 especially when Omicron is included. The low N disorder (i.e., low content of intrinsically disordered residues in the nucleocapsid (N) protein), first observed in pangolin-CoV-2017 amd later in Omicron, is associated with attenuation according to the Shell-Disorder-Model. Our experimental study revealed that pangolin-CoV-2017 and SARS-CoV-2 Omicron (XBB.1.16 subvariant) show similar attenuations with respect to viral growth and plaque formation. Subtle differences have been observed that are consistent with disorder-centric computational analysis.

This study introduces a specialized Automatic Speech Recognition (ASR) system, leveraging the Whisper Large-v2 model, specifically adapted for radiological applications in French language. Our methodology focused on adapting the model to accurately transcribe medical terminology and diverse accents within the French language context, achieving a notable Word Error Rate (WER) of 17.121%. The research involved extensive data collection and preprocessing, utilizing a wide range of French medical audio content. The results demonstrate the system's effectiveness in transcribing complex radiological data, underscoring its potential to enhance medical documentation efficiency in French-speaking clinical settings. The discussion extends to the broader implications of this technology in healthcare, including its potential integration with Electronic Health Records (EHRs) and its utility in medical education. The study also explores future research directions, such as tailoring ASR systems to specific medical specialties and languages. Overall, this research contributes significantly to the field of medical ASR systems, presenting a robust tool for radiological transcription in the French language and paving the way for advanced technology-enhanced healthcare solutions.

Mycoplasma synoviae (MS) is a highly contagious bacteria that can cause significant harm in commercial poultry populations while not prevented. Rapid detection of its presence in a flock is crucial from the perspective of animals' health and economic income. Authors propose spectral measurements strongly backed up by the AI data processing algorithms for classifying egg origin: from healthy hens or MS-infected ones. The newest obtained classification factors are F-scores for white eggshells 99% and for brown eggshells 99%—all data used for classification were taken by the portable multispectral fibre-optics reflectometer.

The growing dependence on large language models (LLM)s highlights the urgent need to deepen trust in these technologies. Regular, rigorous validation of their expertise, especially in nuanced and intricate scenarios, is essential to ensure their readiness for clinical applications. Our study pioneers the exploration of LLM utility in the field of cardiology. We stand at the cusp of a transformative era where mature AI and LLMs, notably ChatGPT, GPT-4, and Google Bard, are poised to influence healthcare significantly. Recently, we put three available LLMs, OpenAI's ChatGPT-3.5, GPT-4.0, and Google's Bard, to the test against a significant Polish medical special-ization licensing exam (PES). The exams cover the scope of completed specialist training, focusing on diagnostic and therapeutic procedures, excluding invasive medical procedures and interven-tions. In our analysis, GPT-4 consistently outperformed the others, ranking first, with and Google Bard and ChatGPT- 3.5 following, respectively. The performance metrics underscore GPT-4's no-table potential in medical applications. Given a score improvement of over 23.5 % between two AI models released just four months apart, clinicians must stay informed and up-to-date about these rapidly evolving tools and their potential applications to clinical practice. Our results provide a snapshot of the current capabilities of these models, highlighting the nuanced performance dif-ferences when confronted with identical questions

Detecting, tracking, and classifying unmanned aerial vehicles (UAVs) in a swarm presents significant challenges due to their small and diverse radar cross-sections, multiple flight altitudes, velocities, and close trajectories. To overcome these challenges, adjustments of the radar parameters and/or position of the radar (for airborne platforms) are often required during runtime. The runtime adjustments help to overcome the anomalies in the detection, tracking, and classification of UAVs. The runtime adjustments are performed either manually or through fixed algorithms, each of which can have its limitations for complex and dynamic scenarios. In this work, we propose the use of multi-agent reinforcement learning (RL) to carry out the runtime adjustment of the radar parameters and position of the radar platform. The radar used in our work is a multibeam multifunction phased array radar (MMPAR) placed onboard UAVs. The simulations show the cognitive adjustment of the MMPAR parameters and position of the airborne platform using RL helps to overcome anomalies in the detection, tracking, and classification of UAVs in a swarm. A comparison with other artificial intelligence (AI) algorithms shows that RL performs better due to runtime learning of the environment through rewards.

Immunotherapy is an effective therapeutic option for several cancers. In the last years, the introduction of checkpoint inhibitors (ICIs) has shifted the therapeutic landscape in oncology and improved patient prognosis in a variety of neoplastic diseases. However, to date, the selection of the best patients eligible for these therapies, as well as the response assessment is still challenging. Patients are mainly stratified using immunohistochemical analysis of the expression of anti-gens on biopsy specimens, such as PD-L1 and PD-1, on tumor cells, on peritumoral immune cells, and/or in the tumor microenvironment (TME). Recently, the use and development of imaging biomarkers able to assess in-vivo cancer-related processes are becoming more important. Today, positron emission tomography (PET) with 2-deoxy-2-[18F]fluoro-D-glucose ([18F]FDG) is used routinely to evaluate tumor metabolism, and also to predict and monitor response to immunotherapy. Although highly sensitive, FDG-PET, in general, is rather unspecific. Novel radiopharmaceuticals (immuno-PET radiotracers) able to identify specific immune system targets are under investigation in pre-clinical and clinical settings. In this review, we will provide an overview of the main new immuno-PET radiotracers in development. We will also review the main players (immune cells, tumor cells, and molecular targets) involved in immunotherapy. Furthermore, we report current applications and the evidence of using [18F]FDG PET in immunotherapy, including the use of artificial intelligence (AI).

Alzheimer's disease (AD) is a significant regular type of dementia that causes damage in brain cells. Early detection of AD acting as an essential role in global health care due to misdiagnosis and sharing many clinical sets with other types of dementia, and costly monitoring the progression of the disease over time by magnetic reasoning imaging (MRI) with consideration of human error in manual reading. Our proposed model, in the first stage, apply the medical dataset to a composite hybrid feature selection (CHFS) to extract new features for select the best features to improve the performance of the classification process due to eliminating obscures features. In the second stage, we applied a dataset to a stacked hybrid classification system to combine Jrip and random forest classifiers with six model evaluations as meta-classifier individually to improve the prediction of clinical diagnosis. All experiments conducted on a laptop with an Intel Core i7- 8750H CPU at 2.2 GHz and 16 G of ram running on windows 10 (64 bits). The dataset evaluated using an explorer set of weka data mining software for the analysis purpose. The experimental show that the proposed model of ‏(CHFS) feature extraction ‏performs better than principal component analysis (PCA), and lead to effectively reduced the false-negative rate with a relatively high overall accuracy with support vector machine (SVM) as meta-classifier of 96.50% compared to 68.83% which is considerably better than the previous state-of-the-art result. The receiver operating characteristic (ROC) curve was equal to 95.5%. Also, the experiment on MRI images Kaggle dataset of CNN classification process with 80.21% accuracy result. The results of the proposed model show an accurate classify Alzheimer's clinical samples against MRI neuroimaging for diagnoses AD at a low cost.

Improving the quality of petroleum products and refining processes through the use of artificial intelligence and machine learning techniques is the topic of this article. It shows that expert knowledge and conventional empirical models can't get you where you want to go in a refining process. To effectively capture complex interactions and forecast fuel qualities, machine learning techniques such as principal component analysis (PCA), support vector machines (SVM), artificial neural networks (ANN), and partial least squares (PLS) are suggested. Gasoline and other petroleum products, as well as property prediction, process control, product quality, and operational efficiency in refineries, can all be improved with the help of machine learning applied to spectral or distillation curve data. An exciting new direction in optimizing operations, meeting environmental norms, and precisely estimating gasoline quality is offered by advanced machine learning algorithms.

The statistical analysis of impact of the top 50 solar flares of X-class (1997-2023) on the global seismic activity, as well as on the earthquake preparation zones located in illuminated part of the globe and in the area of 5000 km radius around the subsolar point was carried out. It is shown by a method of epoch superposition that for all cases the increase of seismicity is observed, especially in the region around the subsolar point (up to 38%) during 10 days after the solar flare in comparison with preceding 10 days. The case study of aftershock sequence of strong M=9.1 earthquake (Su-matra-Andaman Islands, 26.12.2004) after the solar flare of X7.2 class (20.01.2005) demonstrated that the number of aftershocks with magnitude M≥2.5 increases more than 20 times after the solar flare with a delay of 7 days. For the case of the Darfield earthquake (M=7.1, 04.09.2010, New Zealand) it was shown that strong solar flares of class X and M probably triggered two strong aftershocks (M>6) with the same delay of 6 days on the Port Hills fault, which is the most sensitive to external electromagnetic impact from point of view of the fault electrical conductivity and orientation. Based on the obtained results the possible application of natural electromagnetic triggering of earthquakes is discussed for a short-term earthquake prediction using confidently recorded strong external electromagnetic triggering impacts on the specific earthquake preparation zones, as well as ionospheric perturbations due to aerosol emission from the earthquake sources recorded by satellites.

The synthesis and characterization of the multicomponent crystals formed by 2,2’-thiodiacetic acid (H2tda) and 2,6-diaminopurine (Hdap) or N9-(2-hydroxyethyl)adenine (9heade) are reported. The crystals are in the salt rather than cocrystal form, as witnessed by single crystal X-ray diffractometry where a structural analysis revealed their ionic nature, confirming the proton transfer from the 2,2’-thiodiacetic acid to the basic groups of the coformers. The new multicomponent crystals have molecular formulas [(H9heade+)(Htda)] (1) and [(H2dap+)2(tda2)]·2H2O (2), and were also characterized by FTIR, elemental analysis as well as thermogravimetric/differential scanning calorimetry (TG/DSC) analyses. In the crystal packing the ions interact with each other via O–H···N, O–H···O. N–H···O and N–H···N hydrogen bonds generating cyclic hydrogen bonded motifs with graph-set notation of R22(16), R22(10), R32(10), R33(10), R22(9), R32(8) and R42(8), to form different supramolecular homo- and hetero-synthons. In addition, in the crystal packing of 2, pairs of diaminopurinium ions display an strong anti-parallel ,-stacking interaction, with short inter-centroids and interplanar distances (3.39 and 3.24 Å respectively) and fairly tight angle (17.5°). These assemblies have been further analyzed energetically by using DFT calculations, MEP surface analysis and QTAIM characterization.

Cotton leaf curl Kokhran virus (CLCuKoV) (genus, Begomovirus; family, Geminiviridae) is highly infectious, widespread and the most dangerous pathogen of cotton (Gossypium hirsutum L.) that is responsible to a serious disorder, cotton leaf curl disease (CLCuD). Begomoviruses are spread very efficiently by the whitefly Bemisia tabaci cryptic species, causing economic losses to cotton crop, all over the world. The ‘Lucknow’ strain of CLCuKoV has emerged as a divergent isolate that could cause CLCuD. The monopartite ssDNA genome of CLCuKoV-Lu (2.7 Kb) contains six open reading frames (ORFs) that was shown to encode four major proteins. RNA interference (RNAi)-based antiviral innate immunity is a sequence-specific biological phenomenon and a powerful tool to control plant viruses. The present study aims to determine cotton locus-derived microRNAs (ghr-miRNAs) that are identified for targeting the CLCuKoV-Lu ss-DNA-encoded mRNAs using a predictive approach that involves four computational algorithms, miRanda, RNA22, psRNATarget and RNAhybrid. Mature ghr-miRNA sequences (n=80) from allotetraploid upland cotton (2n = 4x = 52) were selected from the miRBase and were tested for alignment with the CLCuKoV-Lu genome. Among the 80 cotton locus-derived ghr-miRNAs evaluated, only one consensus cotton locus-derived ghr-miRNA (ghr-miR2950) was concluded to have effective ghr-miRNA target site at common nucleotide position 82 in the CLCuKoV-Lu genome respectively, using a stringent criterion, identified by all the algorithms used. The miRNA targeting is reliant on base pairing of miRNA-mRNA target pairings. Conservation of the hybridization binding site of the predicted ghr-miR2950 was validated using multiple sequence alignment within all the strains of CLCuKoV. We constructed a regulatory interaction network of miRNA–mRNA to identify novel targets. The efficacy of the predicted miRNAs against CLCuKoV-Lu was evaluated by RNAi-mediated targeted mRNA cleavage. The current investigated miRNA targets provide evidence for the development of CLCuD-resistant cotton plants.

Transportation authorities aim to boost road safety by identifying risky locations and applying suitable safety measures. The Highway Safety Manual (HSM) is a vital resource for US transportation professionals, aiding in the creation of Safety Performance Functions (SPFs), which are predictive models for crashes. These models rely on Negative Binomial distribution-based regression and misinterpreting them due to unmet statistical assumptions can lead to erroneous conclusions, including inaccurately assessing crash rates or missing high-risk sites. The Florida Department of Transportation (FDOT) has introduced context classifications to HSM SPFs, complicating assumption violation identification. This study, part of an FDOT-sponsored project, investigates established statistical diagnostic tests to identify model violations and proposes a novel approach to determine optimal spatial regions for Empirical Bayes adjustment. This adjustment aligns HSM-SPFs with regression assumptions. The study employs a case study involving Florida roads. Results indicate that a 20-mile radius offers an optimal spatial sample size for modeling crashes of all injury levels, ensuring accurate assumptions. For severe injury crashes, which are less frequent and harder to predict, a 60-mile radius is suggested to fulfill statistical modeling assumptions. This methodology guides FDOT practitioners in assessing the conformity of HSM-SPFs with intended assumptions and determining appropriate region sizes.

Strong convective storms can be a serious threat to modern society, influencing both the economy and human life. Thunderstorms can bring much-needed rain after a dry spell, but the nature of thunderstorm mostly causes damage due to high wind associated with it and heavy intensity rain that mostly causes quick overlandflow and flashfloods. The paper focused on the 2011 Pukkelpop event in Belgium where due to heavy thunderstorm a lot of financial damage occurred, and five casualties. In this paper we look into the basic elements that enforces the creation of a thunderstorm like CAPE and windshear. A representative grid has been taken from the Alaro-0 model of 12.5 km resolution for the analysis of the thunderstorm over Belgium which is detailed out in the methodology. The model runs of Alaro-0 from Royal Meteorological Institute of Belgium (RMI) is used for historical and future years for CAPE and Shear. We look into STEnv which is a composite number that can provide some insight on occurrence of thunderstorm, and STEnv is when CAPE*Shear exceeds certain threshold. In this study the threshold has been chosen as 97%. Only summer months have been taken into account into this study as summer(s) has the most thunderstorm in Belgium. The analysis of CAPE and STEnv over historical period (1977-2005), near future (2041-2069) and far future (2071-2099) shows significant increase in occurrence of thunderstorm in the 2071-2099s, specially in extreme cases such as 97% and 99% quantile. CAPE (J/Kg) increases in all future scenarios compared to the historical period. In 2071-2099s, CAPE increases from 2100 J/Kg to 2300 J/Kg (90% quantile) and from 3500 J/Kg to 3900 J/Kg (99% quantile) compared to the historical period. The number of STEnv increases from 300 to 378 in top 10% storm case (90% quantile), 158 to 218 in top 5% storm (95% quantile), 97 to 153 in top 3% storm (97% quantile) and 33 to 66 in top 1% storm (99% quantile) with a 90% confidence interval overall. Shear mostly remains unchanged. The study also shows spatial variation of CAPE, shear and STEnv over Belgium for present and future scenarios in different extremities (90%, 95%, 97% and 99% quantiles). There is a good indication that increase in CAPE translates to increase in STEnv, which is an accepted measure to predict occurrence of thunderstorm. Future climate change also amplifies the occurrence of thunderstorm, which is coherent with relevant studies. The uncertainty related to the study can be reduced with more detailed dataset and involvement of numerical weather prediction models beyond data statistics.

Anti-islet autoantibodies serve as key markers in immune-mediated type 1 diabetes (T1D) and slowly-progressive T1D (SPIDDM), also known as latent autoimmune diabetes in adults (LADA). Autoantibodies to insulin (IAA), glutamic acid decarboxylase (GADA), tyrosine phosphatase-like protein IA-2 (IA-2A), and zinc transporter 8 (ZnT8A) are currently employed in the diagnosis, pathological analysis, and prediction of T1D. GADA can also be detected in non-diabetic patients with autoimmune diseases other than T1D and may not necessarily reflect insulitis. Conversely, IA-2A and ZnT8A serve as surrogate markers of pancreatic β-cell destruction. Combinatorial analysis of these four anti-islet autoantibodies demonstrated that 93-96% of acute-onset T1D and SPIDDM cases were diagnosed as immune-mediated T1D, while the majority of fulminant T1D cases were autoantibody-negative. Evaluating the epitopes and immunoglobulin subclasses of anti-islet autoantibodies help distinguish between diabetes-associated and non-diabetes-associated autoantibodies and is valuable for predicting future insulin deficiency in SPIDDM (LADA) patients. Additionally, GADA in T1D patients with autoimmune thyroid disease reveals the polyclonal expansion of autoantibody epitopes and immunoglobulin subclasses. Recent advancements in anti-islet autoantibody assays include nonradioactive fluid-phase assays and the simultaneous determination of multiple biochemically defined autoantibodies. Developing a high-throughput assay for detecting epitope-specific or immunoglobulin isotype-specific autoantibodies will facilitate more accurate diagnosis and prediction of autoimmune disorders.

(1) Birth asphyxia is the major cause for delivery room resuscitation. Subsequent organ failure and hypoxic-ischemic encephalopathy (HIE) account for 25% of all early postnatal deaths. The neonatal Sequential Organ Failure Assessment (nSOFA) considers platelet count, respiratory and cardiovascular dysfunction in neonates with sepsis. To evaluate whether nSOFA is also a useful predictor for in-hospital mortality in neonates (≥ 36+0 weeks of gestation (GA)) following asphyxia with HIE and therapeutic hypothermia (TH), (2) nSOFA was documented at ≤ 6 hours of life. (3) 65 infants fulfilled inclusion criteria for TH. All but one infant received cardiopulmonary resuscitation and/or respiratory support at birth. nSOFA was lower in survivors (median 0 [IQR 0-2]; n = 56, median GA 39+3, female n = 28 (50%)) than in non-survivors (median 10 [4-12], p < 0.001; n = 9, median GA 38+6, n = 4 (44.4%)). This was also observed for the respiratory (p < 0.001), cardiovascular (p < 0.001), and hematologic sub scores (p = 0.003). The odds ratio for mortality was 1.6 [95% CI = 1.2 – 2.1] per one-point increase in nSOFA. The optimal cut-off value of nSOFA to predict mortality was 3.5 (sensitivity 100.0%, specificity 83.9%). (4) Since early accurate prognosis following asphyxia with HIE and TH is essential to guide end-of-life decisions, nSOFA (≤ 6 hours of life) offers the potential to identify infants at risk of mortality.

As one of the fastest-growing new energy sources, wind power technology has attracted widespread attention from all over the world. In order to improve the quality of wind power generation, wind speed prediction is an indispensable task. In this paper, an error correction based Variational Mode Decomposition and Broad Learning System (VMD-BLS) hybrid model is proposed for wind speed prediction. First, the wind speed is decomposed into multiple components by the VMD algorithm, and then an ARMA model is established for each component to find the optimal number of sequence divisions. Second, the BLS model is used to predict each component, and the prediction results are summed to obtain the wind speed forecast value. However, in some traditional methods, there is always time lag, which will reduce the forecast accuracy. To deal with this, a novel error correction technique is developed by utilizing BLS. Through verification experiment with actual data, it proves that the proposed method can reduce the phenomenon of prediction lag, and can achieve higher prediction accuracy than traditional approaches, which shows our method’s effectiveness in practice.

While thunderstorms can pose severe risks to property and life, forecasting remains challenging, even at short lead times, as these often arise in meta-stable atmospheric conditions. In this paper, we examine the question of how well we could perform short-term (up to 180min) forecasts using exclusively multi-spectral satellite images and past lighting events as data. We employ representation learning based on deep convolutional neural networks in an “end-to-end” fashion. Here, a crucial problem is handling the imbalance of the positive and negative classes appropriately in order to be able to obtain predictive results (which is not addressed by many previous machine-learning-based approaches). The resulting network outperforms previous methods based on physically-based features and optical flow methods (similar to operational prediction models) and generalizes across different years. A closer examination of the classifier performance over time and under masking of input data indicates that the learned model actually draws most information from structures in the visible spectrum, with infrared imaging sustaining some classification performance during the night.

The following article presents an analysis of the determinants of diabetes using a dataset containing the surveys of 2000 patients from the Frankfurt Hospital in Germany. The data were analyzed using the following models, namely: Tobit, Probit, Logit, Multinomial Logit, OLS, WLS with heteroskedasticity. The results show that the presence of diabetes is positively associated with "Pregnancies", "Glucose", "BMI", "Diabetes Pedigree Function", "Age" and negatively associated with "Blood Pressure". A cluster analysis is realized using the fuzzy c-Means algorithm optimized with the Elbow method and three clusters were found. Finally a confrontation among eight different machine learning algorithms is realized to select the best performing algorithm to predict the probability of patients to develop diabetes.

Burrs form due to plastic deformation of materials during machining processes, such as milling and drilling. Deburring can be very difficult when the burrs are not easily accessible for removal. In this study, abrasive flow machining (AFM) was adopted for deburring the edges of milling specimens. Based on the experimental observations on AL6061 specimens, the deburring performance was characterized in terms of flow speed, the local curvature of the streamline near the burr edge, and shear stress. A new objective function that can predict the extent of deburring is proposed based on these characteristics and validated through experiments. Based on this new objective function, a prediction of deburring performance on the burr edge of the intersecting holes with offset was performed. The results between the predicted and experimental observation results were in reasonable agreement.

Concussion, also known as mild traumatic brain injury (mTBI), commonly causes transient neurocognitive symptoms, but in some cases, it causes cognitive impairment, including working memory (WM) deficit, which can be long-lasting and impede a patient’s return to work. The predictors of long-term cognitive outcomes following mTBI remain unclear because abnormality is often absent in structural imaging findings. The purpose of the study was to determine whether machine learning-based models using functional magnetic resonance imaging (fMRI) biomarkers and demographic or neuropsychological measures at baseline could effectively predict 1-year cognitive outcomes of concussion. We conducted a prospective, observational study of patients with mTBI who were compared with demographically-matched healthy controls enrolled between September 2015 to August 2020. Baseline assessments were collected within the first week of injury, and follow-ups were conducted at 6 weeks, 3 months, 6 months, and 1 year. Potential demographic, neuropsychological, and fMRI features were selected according to the significance of correlation with the estimated changes in WM ability. The support vector machine classifier was trained using these potential features and estimated changes in WM between the predefined time periods. Patients demonstrated significant cognitive recovery at the third month, followed by worsened performance after 6 months, which persisted until 1 year after concussion. Approximately half of the patients experienced prolonged cognitive impairment at 1-year follow up. Satisfactory predictions were achieved for patients whose WM function did not recover at 3 months (accuracy=87.5%), 6 months (accuracy=83.3%), 1 year (accuracy=83.3%), and performed worse at 1-year follow-up compared to baseline assessment (accuracy=83.3%). This study demonstrated the feasibility of personalized prediction for long-term postconcussive WM outcomes based on baseline fMRI and demographic features, opening a new avenue for early rehabilitation intervention in selected individuals with possible poor long-term cognitive outcomes.

This paper presents a methodology for determining the sensitivity of the main air flow directions in ventilation subnetworks to changes of aerodynamic resistance and of air density in mine workings. Formulae for determination of the sensitivity of the main subnetwork air flows by establishing the degree of dependency of the air volume stream in a given working on the variations in resistance or air density of other workings of the network have been developed. They have been implemented in the VentGraph mine ventilation network simulator. This software, widely used in Polish collieries provides an extended possibility to predict the process of ventilation, air distribution and, in the case of underground fire, also the spread of combustion gasses. The new method facilitates assessment by mine ventilation services of the stability of ventilation systems in exploitation areas and determine of the sensitivity of the main subnetwork air flow directions to changes of aerodynamic resistance and air density. Recently in some Polish collieries new longwalls are developed in seams located deeper then the bottom of the intake shaft. Such solution is called “exploitation below the level of access” or “sublevel”. The new approach may be applied to such developments to assess the potential of changes of direction and air flow rates. In addition, interpretation of the developed sensitivity indicator is presented. While analyzing air distributions for sublevel exploitation, application of current numerical models for calculations of the distribution results in tangible benefits, such as the evaluation of the safety or risk levels for such exploitation. Application of the VentGraph computer program, and particularly the module POŻAR (fire) with the newly developed options, enables an additional approach to the sensitivity indicator in evaluating air flow safety levels for the risks present during exploitation below the level of the intake shaft. The analyses performed and examples presented enabled useful conclusions in mining practice to be drawn.

Despite significant advancements in Artificial Intelligence (AI) and Large Language Models (LLMs), detecting and mitigating bias remains a critical challenge, particularly within social media platforms like X (formerly Twitter) and in addressing cyberbullying present on them. This research investigates the effectiveness of leading LLMs in generating synthetic biased and cyberbullying data and evaluates the proficiency of Transformer AI models in detecting bias and cyberbullying within both authentic and synthetic contexts. The study involves semantic analysis and feature engineering on a dataset of over 48,000 sentences related to cyberbullying collected from Twitter (before it became X). Leveraging state-of-the-art LLMs such as ChatGPT-4o, Pi AI, Claude 3 Opus, and Gemini-1.5, synthetic biased, cyberbullying, and neutral data were generated to deepen the understanding of bias in human-generated data. AI models including DeBERTa, Longformer, BigBird, HateBERT, MobileBERT, DistilBERT, BERT, RoBERTa, ELECTRA, and XLNet were initially trained to classify Twitter cyberbullying data and subsequently fine-tuned, optimized, and quantized for multilabel classification (detecting both biases and cyberbullying). The study's outcomes include a prototype of a hybrid application that combines a Bias Data Detector and a Bias Data Generator, validated through extensive testing.

The spread of fake news poses a serious threat to public trust and informed decision-making. The emergence of AI-generated fake news exacerbates this issue, as it can be produced more rapidly and convincingly than human-generated content. Addressing this issue, our paper introduces a robust approach to detect AI-generated fake news that is applicable across major disinformation domains: Politics and Elections, Health and Medicine, Science and Technology, and Entertainment and Celebrities. Our models differentiate between AI-generated and human-generated news articles while assessing their truthfulness. Utilizing large language models such as ChatGPT, we curated datasets spanning both AI and human generated fake and genuine news. Following extensive data preprocessing and the application of diverse feature extraction techniques, our models were trained using multiple machine learning algorithms. Our results show the feasibility of accurately identifying AI-generated fake news, thereby adding a significant layer of defense in combating misinformation across various sectors. In addition, we have explored the potential utility of transferable machine learning models trained on data from one domain (e.g., politics), when tested on another domain (e.g., health).

Alzheimer's disease (AD) detection acting as an essential role in global health care due to misdiagnosis and sharing many clinical sets with other types of dementia, and costly monitoring the progression of the disease over time by magnetic reasoning imaging (MRI) with consideration of human error in manual reading. This paper goal a comparative study on the performance of data mining techniques on two datasets of Clinical and Neuroimaging Tests with AD. Our proposed model in the first stage, Apply clinical medical dataset to a composite hybrid feature selection (CHFS), for extract new features to select the best features due to eliminating obscures features, In parallel with Apply a novel hybrid feature extraction of three batch edge detection algorithm and texture from MRI images dataset and optimized with fuzzy 64-bin histogram. In the second stage, we applied a clinical dataset to a stacked hybrid classification(SHC) model to combine Jrip and random forest classifiers with six model evaluations as meta-classifier individually to improve the prediction of clinical diagnosis. At the same stage of improving the classification accuracy of neuroimaging (MRI) dataset images by applying a convolution neural network (CNN) in comparison with traditional classifiers, running on extracted features from images. The authors have collected the clinical dataset of 426 subjects with (1229 potential patient sample) from oasis.org and (MRI) dataset from a benchmark kaggle.com with a total of around ~5000 images each segregated into the severity of Alzheimer's. The datasets evaluated using an explorer set of weka data mining software for the analysis purpose. The experimental show that the proposed model of ‏(CHFS) feature extraction ‏ lead to effectively reduced the false-negative rate with a relatively high overall accuracy with a stack hybrid classification of support vector machine (SVM) as meta-classifier of 96.50% compared to 68.83% of the previous result on a clinical dataset, Besides a compared model of CNN classification on MRI images dataset of 80.21%. The results showed the superiority of our CHFS model in predicting Alzheimer's disease more accurately with the clinical medical dataset in early-stage compared with the neuroimaging (MRI) dataset. The results of the proposed model were able to predict with accurately classify Alzheimer's clinical samples at a low cost in comparison with the MRI-CNN images model at the early stage and get a good indicator for high classification rate for MRI images when applying our proposed model of SHC.

The climate covers a series of events that deeply affect human life. It is possible to understand these events through spatial and statistical analyzes. Today, climate change, which is one of the most important of these events and the impact factors of consequences of this change, become a current issue. Drought is cited as one of the consequences of climate change and it is important to examine it with various methods as it can give negative results to both the economy and the nature. In this study, the drought status of the regions where these stations are located and the effects of drought on climate change were statistically calculated and evaluated using Standardized Precipitation Index (SPI), Percentage of Normal Index (PNI), Aridity Index (AI) and Standardized Precipitation -Evopotranspiration Index (SPEI). The precipitation data from 1981 to 2010 were obtained from Cihanbeyli, Karapınar, Çumra, Seydişehir, Kulu, Ereğli, Niğde, Karaman, Beyşehir and Aksaray meteorology stations affiliated to Turkish State Meteorological Service. At the same time, factor analysis and validity-reliability analysis were conducted to test the computability of the indices used in the study as a single index and to determine the reliability of the operations. While using exploratory factor analysis, Kaiser-Meyer-Olkin (KMO) test and Barlett test for factor analysis; Cronbach's alpha coefficient was used for reliability analysis. In our study, K-Means Cluster Analysis method was performed to determine the cutoff values of indices. According to the result of cluster analysis for the new (common) index, new clusters were created and ANOVA test was conducted to determine whether there was a difference between clusters.

In the rapidly evolving field of real estate economics, the prediction of house prices continues to be a complex challenge, intricately tied to a multitude of socio-economic factors. However, traditional predictive models have often overlooked the spatial interdependencies that play a vital role in shaping housing prices. This study applies Graph Neural Networks (GNNs) on Open Statistics Knowledge Graphs to model spatial dependencies and predict house prices across Scotland’s 2011 data zones. To this end, integrated statistical indicators are retrieved from the official Scottish Open Government Data portal. The three representative GNN algorithms employed - ChebNet, GCN, and GraphSAGE - demonstrate higher prediction accuracy than traditional models, including the tabular-based XGBoost and a simple Multi-Layer Perceptron (MLP). In addition, local and global explainability are employed to increase transparency and trust in the predictions made by the most accurate GNN - GraphSAGE. The global feature importance is determined by a logistic regression surrogate model while the local, region-level understanding of the GNN predictions is achieved through the use of GNNExplainer. Explainaibility results are compared with those from a previous work that applied the XGBoost machine learning algorithm and the SHapley Additive exPlanations (SHAP) explainability framework on the same dataset. Interestingly, both global surrogate model and the SHAP approach underscored the Comparative Illness Factor, a health indicator, and the ratio of detached dwellings as the most crucial features in the global explainability. In the case of local explanations, while both methods showed similar results, the GNN approach provided a richer, more comprehensive understanding of the predictions for two specific data zones.

This review focuses on the emerging evidence for the association between estimated cardiorespiratory fitness (eCRF) and metabolic risk factors. Given the challenges associated with directly measuring cardiorespiratory fitness (CRF) in large populations, eCRF presents a practical alternative for predicting metabolic health risks. A literature search identified six relevant cohort studies from 2021 to 2024 that investigated the association of eCRF with hypertension, hyperglycemia, dyslipidemia, and obesity. The review findings highlight a consistent inverse relationship between higher eCRF and lower incidence of metabolic risks in line with CRF cohort studies. This review highlights the importance of low eCRF as a primordial indicator for metabolic risks and underscores the need for broader application. Future research directions should include exploring eCRF's predictive accuracy across diverse populations and health outcomes and testing its real-world applicability in healthcare and public health settings.

The incorporation of renewable energy systems in the world energy system has been steadily increasing during the last years. In terms of the building sector, the usual consumers are becoming increasingly prosumers, and the trend is that communities of energy, whose households share produced electricity, will increase in number in the future. Another observed tendency is that the aggregator (the entity that manages the community) trades the net community energy in public energy markets. To accomplish economically good transactions, accurate and reliable forecasts of the day-ahead net energy community must be available. These can be obtained using an ensemble of multi-step shallow artificial neural networks, with prediction intervals obtained by the covariance algorithm. Using real data obtained by a small energy community of four houses located in the South region of Portugal, one can verify that the deterministic and probabilistic performance of the proposed approach is at least similar, typically better than using complex, deep models.

In a recent paper, we extended previous studies on solar-terrestrial relationships by investigating the origin of the March 2012 heatwave in northeast USA. In the present study we check the possible relationship of solar activity with the early March 2012 bad weather in northeast Thrace, Greece. To this end, we examined data from various remote sensing instrumentation monitoring the Sun (SDO satellite), the Interplanetary Space (ACE satellite), the Earth’s magnetosphere (Earth based measurements, NOAA-19 satellite), the top of the clouds (TERRA and AQUA satellites) and the near ground atmosphere. Our comparative data analysis suggests that: (i) the winter-like weather (rainfall, fast winds, decreased temperature) in Thrace started on 6 March 2012, on the same day as the heatwave starting in USA, (ii) during the March 2012 winter-like event in Thrace (6-15 March), the ACE satellite recorded enhanced fluxes of solar energetic particles (SEPs), while SOHO and PAMELA recorded solar protons at very high energies (> 500 MeV), (iii) Thrace experienced particularly intense cyclonic circulation, during periods of magnetic storms on 8 - 10 and 12-13 March, which occurred after the arrival at ACE of two interplanetary shock waves, on March 8 and March 11, respectively, (iv) at the beginning of the two above mentioned periods large atmospheric electric fields were recorded, with values ranging between ~-2000V/m - ~1800V/m on 8 March, (v) the winter-like 8-10 March 2012 weather occurred after the detection of the main SEP event related with a coronal mass ejection released in the interplanetary space as a result of intense solar flare activity observed by SDO on 7 March 2012, (vi) the 8-10 March weather was related with a deep drop of ~630C in the cloud top temperature measured by MODIS/TERRA, which favors strong precipitation. Finally, we analyzed data from the electric power network in Thrace (~410N) and we found, for the first time sudden voltage changes of ~3.5kV in the electric grid in Greece, during the decay phase of the March 2012 superstorm. We discuss the winter-like March 2012 event in Thrace in terms of solar cosmic ray influence on the low troposphere mediated by positive NAO. Finally, we infer that the novel finding of the geomagnetic effects on the electric power grid in Thrace may open a new window into space weather applications research.

Human-Robot Interaction (HRI) for collaborative robots has become an active research topic recently. Collaborative robots assist the human workers in their tasks and improve their efficiency. But the worker should also feel safe and comfortable while interacting with the robot. In this paper, we propose a human-following motion planning and control scheme for a collaborative robot which supplies the necessary parts and tools to a worker in an assembly process in a factory. In our proposed scheme, a 3-D sensing system is employed to measure the skeletal data of the worker. At each sampling time of the sensing system, an optimal delivery position is estimated using the real-time worker data. At the same time, the future positions of the worker are predicted as probabilistic distributions. A Model Predictive Control (MPC) based trajectory planner is used to calculate a robot trajectory that supplies the required parts and tools to the worker and follows the predicted future positions of the worker. We have installed our proposed scheme in a collaborative robot system with a 2-DOF planar manipulator. Experimental results show that the proposed scheme enables the robot to provide anytime assistance to a worker who is moving around in the workspace while ensuring the safety and comfort of the worker.

Optical characterization and thermal aging tests are performed on a sputter-deposited coating, consisting of SiO₂/Cr₂O₃/Cr/Cr₂O₃ layers, designed and developed as a selective solar absorber to be used for unconcentrated solar thermal applications. Both measurements are performed by using a home-made apparatus, which mimics a flat plate collector under high vacuum. A Performance Criterion (PC_η(T)), based on absorber efficiency is proposed, and a forecast of service lifetime is obtained. As a result of the thermal aging tests, the selective solar absorber under study appears to be highly efficient at mid temperatures (up to 573 K) and thermally stable at temperatures (up to 690 K).

In contrast to normal cells, tumor cells of multiple entities overexpress the Heat Shock Protein 70 (Hsp70) not only in the cytosol, but also present it on their plasma membrane in a tumor-specific manner. Furthermore, membrane-Hsp70 positive tumor cells actively release Hsp70 into lipid microvesicles termed exosomes into the blood. Due to conformational changes of Hsp70 in the lipid environment, most commercially available antibodies fail to detect membrane-bound and exosomal Hsp70. To fill this gap and to assess the role of exosomal Hsp70 in the circulation as a potential tumor biomarker, we established the novel complete Hsp70 (compHsp70) sandwich ELISA using two monoclonal antibodies (mAbs) that are able to recognize both, free and lipid-associated Hsp70 on the cell surface of viable tumor cells and exosomes. The epitopes of the mAbs cmHsp70.1 (aa 451-461) and cmHsp70.2 (aa 614-623) that are conserved among different species reside in the substrate-binding domain of Hsp70, with measured affinities of 0.42 nM and 0.44 nM, respectively. Validation of the compHsp70 ELISA revealed a high intra- and inter-assay precision, linearity in a concentration range of 1.56 to 25 ng/ml, high recovery rates of ‘spiked’ liposomal Hsp70 (>84%), comparable values between human serum and plasma samples, and no interference by food intake or age of the donors. Hsp70 concentrations in the circulation of patients with glioblastoma, squamous cell or adeno non-small cell lung carcinoma (NSCLC) at diagnosis were significantly higher than those of healthy volunteers. Hsp70 concentrations dropped concomitantly with the decrease in viable tumor mass on irradiation of patients with approximately 20 Gy (range 18 – 22.5 Gy) or after completion of radiotherapy (60 - 70 Gy). In summary, the compHsp70 ELISA presented herein provides a highly sensitive and reliable tool for measuring free and exosomal Hsp70 in liquid biopsies of tumor patients, levels of which can be used as a predictive tumor-specific biomarker, risk assessment and for monitoring therapeutic outcome.

The accurate prediction of the solar Diffuse Fraction (DF), sometimes called the Diffuse Ratio, is an important topic for solar energy research. In the present study, the current state of Diffuse Irradiance research is discussed and then three robust, Machine Learning (ML) models, are examined using a large dataset (almost 8 years) of hourly readings from Almeria, Spain. The ML models used herein, are a hybrid Adaptive Network-based Fuzzy Inference System (ANFIS), a single Multi-Layer Perceptron (MLP) and a hybrid Multi-Layer Perceptron-Grey Wolf Optimizer (MLP-GWO). These models were evaluated for their predictive precision, using various Solar and Diffuse Fraction (DF) irradiance data, from Spain. The results were then evaluated using two frequently used evaluation criteria, the Mean Absolute Error (MAE) and the Root Mean Square Error (RMSE). The results showed that the MLP-GWO model, followed by the ANFIS model, provided a higher performance, in both the training and the testing procedures.

Transcriptional regulations have been widely studied as one of the main bridges between biology and other basic sciences as well as medicine. The traffic across it has been mostly unidirectional: chemistry and physics provided a lot of tools for biology, although the supply is now saturating. The traffic in opposite direction, the supply of subjects to develop chemistry and physics, has been only a little. However, if there are any, the supply will be at least from transcription, because the notion of chemical reaction is the strongest. This topic is aimed to increase the opposite traffic by introducing the forefront of physicochemical studies of transcription.

In crystal structure prediction, Newton's second law can always be applied to particles (atoms or ions) in a cell to determine their positions. However the values of the period vectors (crystal cell edge vectors) should be determined as well. Here we applied the dynamical equations of period vectors derived recently based on Newton's laws (doi:/10.1139/cjp-2014-0518) for that purpose, where the period vectors are driven by the imbalance between the internal and external pressures/stresses. For equilibrium states, they became equations of state, which essentially turn out the equilibrium conditions of crystals from mechanical point of view. For external pressure, by ignoring some effects, they reduced to the Mie-Gruneisen equation. Since the internal stress has both a full kinetic energy term and a full interaction term, the influences of both external temperature and stress/pressure on crystal structures can be calculated, then thermodynamical properties and processes were presented. Contrary to usual ideas, the equations show that pure harmonic vibrating phonons can result in thermal expansion in crystals when the external temperature is changed. Finally, crystal system collapse due to temperature and/or stress/pressure change was discussed.

Confidence in intermodal transport has not yet been defined. There are many different approaches to the concept of trust. However, the authors embedded them in the light of the challenges of sustainability, linking with the shift paradigm. The objective of the article is to indicate the directions and criteria for the implementation of the shift paradigm, inscribed in the idea of sustainable transport. The auxiliary objective is to predict which countries in a given year will have the TRUST status, i.e. implement the shift paradigm, and which will not implement it (DISTRESS). The article uses taxonometric techniques and built a model using General Discriminant Analysis. On their basis, the utility function was approximated, including the directions of implementation of the shift paradigm depending on the scale of the environmental load of transport. In the course of the research, an original and innovative econometric model was constructed, pointing to three variables, which had the greatest impact on trust. Thanks to the cognitive value of the model, it is possible to identify individuals who deserve the trust, i.e. it will implement the shift paradigm, with 93% probability. In the future, it is worth expanding the research by models for each country.

SARS-CoV-2 Omicron variant spike RBD epitopes in complex with spike (S) -protein D614G mutations now predominate globally and increase infectivity by assembling more functional S proteins into the virion. On average, homeopathic medicine contains less than one molecule per dose on average. Single variable SphericalHarmonicY, LaguerreL, WhittakerM, SphericalBesselJ, LegendreP, LegendreQ, LaguerreL, ChebyshevT, and Hypergeometric1F1 Functions pFqarise in connection with the power series solution of the Schrodinger equation or in the summation of perturbation expansions in quantum mechanics. A quantum interpretation of the homeopathic method is presented here through a novel algebraic topology approach to supersymmetry and symmetry breaking in quantum fields and quantum gravity theory with the aim of developing a wide range of physical-based drug design applications in a Small Molecule Quantized Water Memory Network suggesting that the Hidden Black Hole Paradox of Information Loss might be solved under suitable conditions.

The rapid convergence of Artificial General Intelligence (AGI), autonomous drones, and applied robotics presents a transformative opportunity for many sectors. However, this advancement also raises critical ethical and existential questions, particularly in warfare. This paper explores the concept of entropy as a metaphor for the potential disorder introduced by these increasingly complex technologies. We examine the risks of AGI surpassing human control in conflict situations, where autonomous decision-making could have disastrous consequences. We then analyze autonomous drones, scrutinizing their impact on warfare tactics and the ethical dilemmas surrounding independent, real-time decision-making. Finally, we investigate applied robotics in military operations, focusing on the delicate balance between enhanced capabilities and the potential for uncontrollable systems. Through a multidisciplinary lens, drawing on technology ethics, military strategy, and AI safety, this paper utilizes the concept of entropy to highlight the need for caution in developing these technologies. We propose a scientifically grounded and ethically sound framework to guide policymakers, technologists, and ethicists in navigating the path between innovation and global stability. This framework concludes with recommendations for responsible development and deployment strategies that can mitigate the risks associated with these powerful tools.

Due to Motor Neurone Diseases, a large population remains disabled worldwide, negatively impacting their independence and quality of life. This typically involves a weakness in the hand and forearm muscles, making it difficult to perform fine motor tasks such as writing, buttoning a shirt, or gripping objects. This project presents a vision-enabled rehabilitation hand exoskeleton to assist disabled persons in their hand movements. The design goal was to create an accessible tool to help with a simple interface requiring no training. This prototype is built on a commercially available glove where a camera and embedded processor were integrated to help open and close the hand, using air pressure, thus grabbing an object. An accelerometer is also implemented to detect the characteristic hand gesture to release the object when desired. This passive vision-based control differs from active EMG-based designs as it does not require individualized training. Continuing the research will reduce the cost, weight, and power consumption to facilitate mass implementation.

ackground: The swift assimilation of Artificial Intelligence (AI) across multiple industries is altering the worldwide economic terrain. Unprecedented opportunities and difficulties are brought about by this revolutionary technology, which has an impact on innovation, trade, labor markets, and security. Objective: The goal of this study is to thoroughly investigate the economic effects of AI by exploring how it may affect labor markets, innovation, trade internationally, and security. The goal is to offer insights that support strategic decision-making and policy formation by examining current trends, opportunities, and difficulties. Results: The research highlights the dual character of artificial intelligence's influence, highlighting both its potential to spur economic expansion and its drawbacks, including the loss of jobs, a lack of standards, and security issues. The study highlights how crucial cooperation is to overcoming these obstacles and realizing AI's full potential. Conclusion: The balancing opportunities and risks becomes critical as AI continues to change the economic landscape. The report promotes proactive steps including ethical AI design guidelines, ongoing worker retraining, and flexible regulatory strategies. As we shape an AI future that puts inclusion, creativity, and responsible governance first, collaboration emerges as a key theme.

This paper provides an in-depth exploration of the role of Big Data and Artificial Intelligence (AI) in advancing dairy farming towards net zero emissions, a critical goal in the face of the global climate crisis. The study emphasizes how these technologies significantly enhance the management of greenhouse gas (GHG) emissions and optimize resource use, thereby contributing to environmental sustainability in agriculture. A key aspect of this transition is the alignment with international climate commitments, such as the Paris Agreement, which are instrumental in steering global efforts toward emission reduction and mitigating climate change. The integration of Big Data and AI in dairy farming emerges as a powerful tool to reduce the sector's environmental impact while sustaining economic growth. The paper delves into the specific applications of these technologies in emission management, including predictive analytics for feed optimization, manure management, and energy efficiency enhancements. It also addresses the broader implications of technological integration in dairy farming, considering aspects like benchmarking standards, data privacy, and the role of policy in fostering sustainable practices. The study underscores the challenges inherent in adopting these advanced technologies, including the need for improved farmer training, data quality, and compatibility with existing systems. It also advocates for enhanced policy frameworks that support sustainable practices, encourage technological adoption, and balance economic viability with environmental responsibility. This comprehensive analysis offers valuable insights into harnessing digital technologies for climate change mitigation and delineates a path for the dairy industry towards achieving net zero emissions, thereby contributing significantly to global environmental sustainability efforts.

The rapid proliferation of information in the digital era underscores the importance of accurate historical representation and interpretation. While artificial intelligence (AI) has shown promise in various fields, its potential for historical fact-checking and gap-filling remains largely untapped. This study evaluates the performance of three large language models (LLMs)—GPT-3.5, GPT-4, and Google- BARD—in the context of predicting and verifying historical events based on given data. A novel metric, "Distance to Reality" (DTR), is introduced to assess the models' outputs against established historical facts. The results reveal a substantial potential for AI in historical studies, with GPT-4 demonstrating superior performance. This paper underscores the need for further research into AI's role in enriching our understanding of the past and bridging historical knowledge gaps.

Color change is the most obvious characteristic of tomato ripening stage and an important indicator of tomato ripening condition, which directly affects the commodity value of tomato. To visualize the color change of tomato fruit in mature stage, a gated recurrent unit network with an encoder-decoder structure that dynamically simulates tomato growth and development with time-dependent lines using tomato color and shape as real-time data was proposed in this paper. Firstly, the .json file was converted into a mask.png file, the tomato mask was extracted, and the tomato was separated from the complex background environment, and the tomato growth and development data set was successfully constructed. Then, a network of gated recurrent units with encoder-decoder structure was constructed to predict the future growth trend of tomato under different greenhouse temperatures. The experimental results showed that for the gated recurrent unit network of encoder-decoder structure proposed, when the hidden layer number was 1 and hidden layer number was 512, a high consistency and similarity between the model predicted image sequence and the actual growth and development image sequence would be realized, and the structural similarity index measure was 0.746. It was proved that when the average temperature was 24.93℃, the average soil temperature was 24.06℃, and the average light intensity was 11.26 Klux, the environment was the most suitable for tomato growth. The environmental data-driven tomato growth model was constructed to explore the growth status of tomato under different environmental conditions, thus to understand the growth status of tomato in time. The statement provided a theoretical foundation for determining the optimal greenhouse environmental conditions to achieve tomato maturity. And it offered recommendations for investigating the growth cycle of tomatoes, as well as technical assistance for standardized cultivation in solar greenhouses.

Background: The Risk of Paradoxical Embolism (RoPE) score was developed to identify stroke-related patent foramen ovale (PFO) in patients with cryptogenic stroke. Methods: We conducted a retrospective analysis of the 2016 to 2020 National Inpatient Sample to determine the performance of modified RoPE score for PFO presence in patients with acute ischemic stroke (AIS). Results: A total of 3,338,805 hospital admissions for AIS were analysed and 3.0% had PFO. Patients with PFO were younger compared to those without PFO (median 63 years vs. 71 years, p&lt;0.001) and fewer were female (46.1% vs. 49.7%, p&lt;0.001). The patients with PFO had greater mean modified RoPE score (4.0 vs. 3.3, p&lt;0.001). The area under the curve for the RoPE score in predicting PFO was 0.625 (95%CI 0.620-0.629). The best diagnostic power of the RoPE score was achieved with a cut point of ≥4 where the sensitivity was 55% and the specificity was 64.2%. A cut point of ≥5 increased specificity (83.1%) at the expense of sensitivity (35.8%). The strongest predictor of PFO was deep vein thrombosis (OR 3.97, 95%CI 3.76-4.20). Conclusions: The modified RoPE score had modest predictive value in identifying patients with PFO among patients admitted with AIS.

This study aimed to evaluate the discrepancies between genetic and visual coat color assignment in the Sarcidano Horse and to elucidate potential reasons. Individual DNA from 90 Sarcidano Horses was used for genetic assignment of coat color to explore the correspondence with individual forms containing phenotypical traits. The MC1R exon 1 and ASIP exon 3 have been genotyped and sequenced to obtain a picture of the coat color distribution in this breed. Surprisingly, once we compared the genetic results with the individual forms reporting the phenotypic data for each subject, a certain degree of non-correspondence between the phenotypic and genetic data in relation to coat color emerged. From the genetic analysis, Chestnuts (n = 58) resulted the most common Sarcidano Horse (n = 58), followed by a quite large number of Blacks (n = 28) and a very small number of Bays (n = 4), whereas phenotypic distribution resulted in 38 Chestnuts, 40 Bays, only 2 Blacks, and 10 Grays (without the possibility of recognizing the true color they carried). Chestnut resulted a very representative coat color, while many horses that visually identified as Bays were genetically Blacks. This discrepancy, that could be due to a variety of individual and external factors, including age, time of year, living situation and dietary condition, suggesting the importance of accurate coat color identification to ensure adequate features registration and reliable prediction of offspring’s coat color.

The land subsidence occurring in goafs after coal mining is a protracted process. The accurate prediction of long-term land subsidence in goafs relies heavily on the availability of long-term monitoring data. However, the scarcity of continuous long-term land subsidence monitoring data subsequent to the cessation of mining significantly hinders the accurate prediction of long-term land subsidence in goafs. To address this challenge, this study proposes an innovative method based on Interferometric Synthetic Aperture Radar (InSAR) for predicting long-term land subsidence of goafs following coal mining. The proposed method employs a concatenation approach that integrates multiple short-term monitoring data from different coal faces, each with distinct cessation times, into a cohesive and uniform long-term sequence by normalizing the subsidence rates. The method was verified using actual monitoring data from the Yangquan No.2 mine in Shanxi Province, China. Initially, coal faces with same shapes but varying cessation times were selected for analysis. Using InSAR monitoring data collected between June and December of 2016, the average subsidence rate corresponding to the duration after coal mining cessation of each coal face was back-calculated. Subsequently, a function relating subsidence rate to the duration after coal mining cessation was fitted to the data. Finally, the relationship between cumulative subsidence and the duration after coal mining cessation was derived by integrating the function. The results indicated that the relationship between subsidence rate and duration after coal mining cessation followed an exponential function for a given coal face, whereas the relationship between cumulative subsidence and duration after coal mining cessation conformed to the Knothe time function. Notably, after the cessation of coal mining, significant land subsidence persisted in the goaf of the Yangquan No.2 mine for a duration ranging from 5 to 10 years. The cumulative subsidence curve along the long axis of the coal face ultimately exhibited an inclined W-shape. The proposed method enables the quantitative prediction of residual land subsidence in goafs, even in cases where continuous long-term monitoring data are insufficient, thus providing valuable guidance for construction decisions above the goaf.

Today, the most powerful approach to detect distant homologs of a protein is based on structure prediction and comparison. Yet this approach is still inapplicable to many viral proteins. Therefore, we developed a powerful sequence-based procedure to identify distant homologs of viral proteins. It relies on 3 main principles: 1) Traces of sequence similarity with a protein can persist beyond the significance cutoff of homology detection programs; 2) Candidate homologs can be identified among proteins with weak sequence similarity to the query, by using "contextual" information, e.g. taxonomy or type of host infected; 3) These candidate homologs can be validated using highly sensitive profile-profile comparison.As a test case, we applied our approach to a protein without known homologs, ORF4 of Lake Sinai virus (which infects bees). We discovered that ORF4 is composed of a domain that has homologs in proteins from >20 taxa of viruses infecting arthropods. We called it “Widespread, Intriguing, Versatile” (WIV) domain because it is found in proteins with a wide variety of domain organizations and functions. For example, WIV is encoded by the NSs protein of tospoviruses, a global threat to food security, which infect plants through arthropod vectors; by the protein encoded by RNA2 ORF1 of chronic bee paralysis virus, a widespread virus of bees; and by various proteins of cypoviruses, which infect the silkworm bombyx mori. WIV has a previously unknown structural fold, according to Alphafold predictions. In some viral species, WIV facilitates infection of arthropods, according to bibliographical evidence

Background: Risk tratification based on pre-test probability may improve the diagnostic accuracy of temporal artery high-resolution compression sonography (hrTCS) in the diagnostic workup of cranial giant cell arteriitis (cGCA). Methods: A logistic regression model with candidate items was derived from a cohort of patients with suspected cGCA (n = 87). The diagnostic accuracy of the model was tested in the derivation cohort and in an independent validation cohort (n = 114) by receiver operator characteristics (ROC)-analysis. The clinical items were composed to a clinical prediction rule, integrated into a stepwise diagnostic algorithm together with CRP-values and hrTCS-values. Results: The model consisted of 4 clinical variables (age &gt; 70, headache, jaw claudication, anterior ischemic optic neuropathy). The diagnostic accuracy of the model for discrimination of patients with and without a final clinical diagnosis of cGCA was excellent in both cohorts (AUC 0.96 and AUC 0.92, respectively). The diagnostic algorithm improved the positive predictive value of hrCTS substantially. Within the algorithm, 32.8% of patients (derivation cohort) and 49.1% (validation cohort) would not have been tested by hrtCS. None of these patients had a final diagnosis of cGCA. Conclusion: A diagnostic algorithm based on a clinical prediction rule improves the diagnostic accuracy of hrTCS.

Large lithium-ion batteries (LIBs) in electric vehicles and energy storage systems demonstrate different performance and lifetime compared to small LIB cells, owing to the size effects generated by the electrical configuration and property imbalance. However, the calculation time for performing life predictions with three-dimensional (3D) cell models is undesirably long. In this paper, a lumped cell model with equivalent resistances (LER cell model) is proposed as a reduced order model of the 3D cell model, which enables accurate and fast life predictions of large LIBs. The developed LER cell model is validated via the comparisons with results of the 3D cell models by simulating a 20-Ah commercial pouch cell (NCM/graphite) and the experimental values. In addition, the LER cell models are applied to different cell types and sizes, such as a 20-Ah cylindrical cell and a 60-Ah pouch cell.

Genomic selection (GS) can accelerate variety improvement when training set (TS) size, and its relationship with the breeding set (BS) are optimized for prediction accuracies (PA) of genomic prediction (GP) models. Sixteen GP algorithms were run on phenotypic best linear unbiased predictors (BLUPs) and estimators (BLUEs) of resistance to both fall armyworm (FAW) and maize weevil (MW) in a tropical maize panel. For MW resistance, 37% of the panel was the TS, and BS was the remainder whilst for FAW, random-based training sets (RBTS) and pedigree-based training sets (PBTS) were designed. PAs achieved with BLUPs varied from 0.66 to 0.82 for MW resistance traits, and, for FAW resistance, 0.694 to 0.714 for RBTS of 37%, and 0.843 to 0.844 for RBTS of 85%, and, these were at least two-fold those from BLUEs. For PBTS, FAW resistance PAs were generally higher than those for RBTS, except for one dataset. GP models generally showed similar PAs across individual traits whilst the TS designation was determinant since a positive correlation (R=0.92***) between TS size and PAs was observed for RBTS and, for the PBTS, it was negative (R=0.44**). This study pioneers the use of GS for maize resistance to insect pests in sub-Saharan Africa.

The increasing popularity of Robo-Advisors highlights the need for sophisticated systems combining big data analytics and deep learning for portfolio optimization. Despite their potential, these AI-driven platforms face notable challenges such as financial data inaccuracies and the risk of overfitting in deep learning models. Overcoming these hurdles requires a concerted effort to enhance reliability and performance. To tackle these challenges effectively, it is imperative to prioritize real-time data integration while minimizing reliance on historical data. By adopting this approach, Robo-Advisors can better adapt to dynamic market conditions, enabling them to provide informed and timely investment recommendations. This proactive stance not only ensures computational efficiency but also fosters investor confidence in the platform's ability to navigate evolving market dynamics. In conclusion, by continually refining data integration methods and reducing dependencies on historical data, Robo-Advisors can offer more accurate and timely recommendations. This not only enhances the overall investor experience but also upholds ethical standards in automated investment platforms.

Google Trends data can be informative for infectious disease incidences, including Lyme disease. However, the use of Google Trends for predictive purposes is underutilized. In this study, we tested the ability of Google Trends search data to predict monthly state-level Lyme disease case counts in the United States. We requested Lyme disease data for the years 2010-2021. We downloaded Google Trends search data on terms for Lyme disease, symptoms of Lyme disease, and diseases with similar symptoms as Lyme disease. We built mixed negative binomial models based on a training dataset (2010-2016) and tested the models on a test dataset (2017-2021). A model was built for each search term and monthly lags of search terms were included as predictors. The highest performing models had high predictive ability, indicated by low Root Mean Squared Errors (RMSEs) and close association between observed and predicted case counts. The highest performing model was for the search term “Summer Flu”, which indicates low specificity of some of the terms. We outline challenges of using Google Trends data, including data availability and a mismatch between geographic units. We discuss opportunities for Google Trends data, including prediction of additional zoonotic diseases and incorporating environmental and companion animal data.

Peat is the main type of peloid used in Polish cosmetic/healing spa facilities. Depending on treatment and origin, peat waste can be contaminated microbiologically, and as result, it has to be incinerated in medical waste incineration plants without energy recovery (local law). Such a situation leads to peat waste management costs increase. Therefore in this work, we checked the possibility of peat waste upcycling to carbonized solid fuel (CSF) using torrefaction. Torrefaction is a thermal treatment process that removes microbiological contamination and improves the fuel properties of peat waste. In work torrefaction conditions (temperature and time) on CSF quality were tested. Parallelly, peat decomposition kinetics using TGA, and torrefaction kinetics with lifetime prediction using macro-TGA were determined. Furthermore, torrefaction theoretical mass and energy balance were determined. The results of the tested peat were compared with reference material (wood), and as result, obtained data can be used to adjust currently used wood torrefaction technologies for peat torrefaction. The results show that torrefaction can improve the high heating value of peat waste from 19.0 MJ x kg-1 to 21.3 MJ x kg-1, peat main decomposition takes place at 200-550 °C following second reaction order (n=2), with an activation energy of 33.34 kJ x mol-1 and pre-exponential factor of 4.40 x 10-1 s-1. Moreover, DSC analysis revealed that peat torrefaction required slightly more energy than wood torrefaction, and macro TGA showed that peat torrefaction has lower torrefaction constant reaction rates (k) than wood 1.05 x 10-5 - 3.15 x 10-5 vs 1.43 x 10-5 - 7.25 x 10-5 s-1.

The evaluation of geometric defects is necessary in order to maintain the integrity of structures over time. These assessments are designed to detect damages of structures and ideally help inspectors to estimate the remaining life of structures. Current methodologies for monitoring structural systems, while providing useful information about the current state of a structure, are limited in the monitoring of defects over time and in linking them to predictive simulation. This paper presents a new approach to the predictive modeling of geometric defects. A combination of segmented from point clouds are parametrized using the convex hull algorithm to extract features from detected defects, and a stochastic dynamic model is then adapted to these features to model the evolution of the hull over time. Describing a defect in terms of its parameterized hull enables consistent temporal tracking for predictive purposes, while implicitly reducing data dimensionality and complexity as well. In this study, 2D point clouds analogous to information derived from point clouds were first generated over simulated life-cycles. The evolutions of point cloud hull parameterizations were modeled as stochastic dynamical processes via autoregressive integrated moving average (ARIMA) and vectorized autoregression (VAR) and compared against ground truth. The results indicate that this convex hull approach provides consistent and accurate representations of defect evolution across a range of defect topologies and is reasonably robust to noisy measurements, however assumptions regarding the underlying dynamical process play a significant the role in predictive accuracy. The results were then validated on experimental data from fatigue testing with high accuracy. Longer term, the results of this work will support finite element model updating for predictive analysis of structural capacity.

Pasmo (Septoria linicola) is a fungal disease causing major losses in seed yield and quality, and stem fibre quality in flax. Pasmo resistance (PR) is quantitative and has low heritability. To improve PR breeding efficiency, the accuracy of genomic prediction (GP) was evaluated using a diverse worldwide core collection of 370 accessions. Four marker sets, including three defined by 500, 134, and 67 previously identified quantitative trait loci (QTL) and one of 52,347 PR-correlated genome-wide single nucleotide polymorphisms, were used to build ridge regression best linear unbiased prediction (RR-BLUP) models using pasmo severity (PS) data collected from field experiments performed during five consecutive years. With five-fold random cross-validation, GP accuracy as high as 0.92 was obtained from the models using the 500 QTL when the average PS was used as the training dataset. GP accuracy increased with training population size, reaching values >0.9 with training population size greater than 185. Linear regression of the observed PS with the number of positive-effect QTL in accessions provided an alternative GP approach with an accuracy of 0.86. The results demonstrate the GP models based on marker information from all identified QTL and the 5-year PS average is highly effective for PR prediction.

Durability monitoring of insecticide-treated nets (ITNs) containing a pyrethroid in combination with a second active ingredient (AI) must be adapted so that the insecticidal bioefficacy of each AI can be monitored independently. An effective way to do this is to measure rapid knock down of a pyrethroid-susceptible strain of mosquitoes to assess the bioefficacy of the pyrethroid component and to use a pyrethroid-resistant strain to measure the bioefficacy of the second ingredient. To allow robust comparison of results across tests within and between test facilities, and over time, protocols for bioefficacy testing must include either characterisation of the resistant strain, standardisation of the mosquitoes used for bioassays, or a combination of the two. Through a series of virtual meetings, key stakeholders and practitioners explored different approaches to achieving these goals. Via an iterative process we decided on the preferred approach and produced a protocol consisting of characterising mosquitoes used for bioefficacy testing before and after a round of bioassays, for example at each time point in a durability monitoring study. We present the final protocol and justify our approach to establishing a standard methodology for durability monitoring of ITNs containing pyrethroid and a second AI.

Lithium-ion batteries with improved energy densities have made understanding the Solid Electrolyte Interphase (SEI) generation mechanisms that cause mechanical, thermal, and chemical failures more complicated. SEI processes reduce battery capacity and power. Thus, a review of this area's understanding is important. It is essential to know how batteries degrade in EVs to estimate battery lifespan as it goes, predict, and minimize losses, and determine the ideal time for a replacement. Lithium-ion batteries used in EVs mainly suffer two types of degradation: calendar degradation and cycling degradation. Despite the existence of several existing works in the literature, several aspects of battery degradation remain unclear or have not been analyzed in detail. This work presents a systematic review of existing works in the literature. The results of the present investigation provide insight into the complex relationships among various factors affecting battery degradation mechanisms. Specifically, this systematic review examined the effects of time, side reactions, temperature fluctuations, high charge/discharge rates, depth of discharge, mechanical stress, thermal stress, and the voltage relationship on battery performance and longevity. The results revealed that these factors interact in complex ways to influence the degradation mechanisms of batteries. For example, high charge currents and deep discharges were found to accelerate degradation, while low temperatures and moderate discharge depths were shown to be beneficial for battery longevity. Additionally, the results showed that the relationship between cell voltage and State-of-Charge (SOC) plays a critical role in determining the rate of degradation. Overall, these findings have important implications for the design and operation of battery systems, as they highlight the need to carefully manage a range of factors to maximize battery performance and longevity. The result is an analysis of the main articles published in this field in recent years. This work aims to present new knowledge about fault detection, diagnosis, and management of lithium-ion batteries based on battery degradation concepts. The new knowledge is presented and discussed in a structured and comprehensive way.

Long unpunctuated texts containing complex linguistic sentences are a stumbling block to processing any low-resource languages. Thus, approaches that attempt to segment lengthy texts with no proper punctuation into simple candidate sentences are a vitally important preprocessing task in many hard-to-solve NLP applications. In this paper, we propose (PDTS) a punctuation detection approach for segmenting Arabic text, built on top of a multilingual BERT-based model and some generic linguistic rules. Furthermore, we showcase how PDTS can be effectively employed as a text tokenizer for unpunctuated documents (i.e., mimicking the transcribed audio-to-text documents). Experimental findings across two evaluation protocols (involving an ablation study and a human-based judgment) demonstrate that PDTS is practically effective in both performance quality and computational cost.

We discuss what we believe could be an improvement in future discussions of the ever-changing brain. We do so by distinguishing different types of brain variability and outlining methods suitable to analyse them. We argue that, when studying brain and behaviour data, classical methods such as regression analysis and more advanced approaches both aim to decompose the total variance into sensible variance components. In parallel, we argue that a distinction needs to be made between innate and acquired brain variability. For varying high-dimensional brain data, we present methods useful to extract their low-dimensional representations. Finally, to trace potential causes and predict plausible consequences of brain variability, we discuss how to combine statistical principles and neurobiological insights to make associative, explanatory, predictive, and causal enquires; but cautions are needed to raise association- or prediction-based neurobiological findings to causal claims.

Air passenger traffic prediction is crucial for the effective operation of civil aviation airports. Despite some progress in this field, the prediction accuracy and methods need further improvement. This paper proposes an integrated approach to the prediction of air passenger index as follows. Firstly, the air passenger index is defined and classified by the K-means clustering method. Based on the mutual information (MI) principle, the information entropy is used to analyze and select the key influencing factors of air passenger travel. By incorporating the MI principle into the support vector regression (SVR) framework, this paper presents an innovative MI-SVR machine learning model used to predict the air passenger index. Finally, the proposed model is validated by passenger throughput data of the Shanghai Pudong International Airport, China. The experimental results prove the model feasibility and effectiveness by comparing them with conventional methods, such as ARIMA, LSTM, and other machine learning models, outperformed by the MI-SVR model. Besides, it is shown that the prediction effect of each model could be improved by introducing influencing factors based on mutual information. The main findings are considered instrumental to the airport operation and air traffic optimization.

Air passenger traffic prediction is crucial for the effective operation of civil aviation airports. Despite some progress in this field, the prediction accuracy and methods need further improvement. This paper proposes an integrated approach to the prediction of air passenger index as follows. Firstly, the air passenger index is defined and classified by the K-means clustering method. Based on the mutual information (MI) principle, the information entropy is used to analyze and select the key influencing factors of air passenger travel. By incorporating the MI principle into the support vector regression (SVR) framework, this paper presents an innovative MI-SVR machine learning model used to predict the air passenger index. Finally, the proposed model is validated by passenger throughput data of the Shanghai Pudong International Airport, China. The experimental results prove the model feasibility and effectiveness by comparing them with conventional methods, such as ARIMA, LSTM, and other machine learning models, outperformed by the MI-SVR model. Besides, it is shown that the prediction effect of each model could be improved by introducing influencing factors based on mutual information. The main findings are considered instrumental to the airport operation and air traffic optimization.

The conventional method used for calculating pavement condition index (PCI) has two major drawbacks: safety problems during pavement inspection, and human error. This paper proposes a method for removing these problems. The proposed method uses surface deflection data in falling weight Deflectometer test to estimate PCI. The data used in this study were derived from 236 pavement segments taken from Tehran-Qom freeway in Iran. The data set was analyzed using multi layers perceptron (MLP) and radial basis function (RBF) neural networks. These neural networks were optimized by levenberg-marquardt (MLP-LM), scaled conjugate gradient (MLP-SCG), imperialist competitive (RBF-ICA), and genetic (RBF-GA) algorithms. After initial modeling with four neural networks mentioned, the committee machine intelligent systems (CMIS) method was adopted to combine the results and improve the accuracy of the modeling. The results of analysis have been verified by the four criteria of average percent relative error (APRE), average absolute percent relative error (AAPRE), root mean square error (RMSE) and standard error (SD). The best reported results belonged to CMIS, including APRE=2.3303, AAPRE=11.6768, RMSE=12.0056, and SD=0.0210.

The next-generation "Industrial Internet of Things" (IIoT) will support "Machine-to-Machine" (M2M) communications for smart Cyber-Physical-Systems and Industry 4.0, and require guaranteed cyber-security. This paper explores hardware-enforced cyber-security for critical infrastructures. It examines a Quantum-Safe "Software-Defined Deterministic IIoT" (SDD-IIoT), with a new forwarding-plane (sub-layer-3a) for deterministic M2M traffic flows. A "Software-Defined-Networking" (SDN) control-plane controls many "SDD Wide Area Networks" (SDD-WANs), realized with FPGAs. The SDN control-plane provides an "Admission-Control/Access-Control" system for network-bandwidth, using collaborating Artificial Intelligence (AI) rule-based "Zero Trust Architectures" (ZTAs). Hardware-enforced access-control eliminates all congestion, BufferBloat, and DoS/DDoS attacks in the forwarding-plane, reduces buffer-sizes by 100,000+ times, and supports ultra-reliable and uItra-low-latency communications in the SDD-WANs. The SDD-WANs can: (i) Encrypt/Authenticate M2M flows using Quantum-Safe ciphers, to withstand attacks by Quantum Computers; (ii) Implement "Guaranteed Intrusion Detection Systems" in FPGAs, to detect cyber-attacks embedded within billions of IIoT packets/second; (iii) Provide guaranteed immunity to external cyber-attacks against critical infrastructure, and exceptionally-strong immunity to internal cyber-attacks; (iv) Save $US100s of billions annually by exploiting FPGAs; and (v) Enable "Quantum Key Distribution" (QKD) Networks by providing a programmable forwarding-plane with "authenticated classical channels" and full-immunity to DoS/DDoS attacks. Extensive experimental results for an SDD-WAN over the European Union are reported.

Alzheimer's disease (AD) is characterized by abnormal amyloid beta (Aβ) plaques and hyperphosphorylated tau in the brain. Aβ plaques precede cognitive impairments and can be detected through amyloid-PET or in cerebrospinal fluid (CSF). Assessing the plasma Aβ42/Aβ40 ratio seems promising for non-invasive and cost-effective detection of brain Aβ accumulation. This approach involves some challenges, including the accuracy of blood-based biomarker measurements and the establishment of clear, standardized thresholds to categorize the risk of developing brain amyloid pathology. Plasma Aβ42/Aβ40 ratio was measured in 277 volunteers without dementia, 70 AD patients and 18 non-AD patients using single-molecule array. Patients (n=88) and some volunteers (n=66) were subject to evaluation of amyloid status by CSF Aβ quantification or PET analysis. Thresholds of plasma Aβ42/Aβ40 ratio were determined based on a Gaussian mixture model, a decision tree, and the Youden index. The 0.0472 threshold, the one with the highest sensitivity, was retained for general population without dementia screening, and the 0.0450 threshold was retained for research and clinical trials recruitment, aiming to minimize the need for CSF or PET analyses to identify amyloid-positive individuals. These findings offer a promising step towards a cost-effective method for identifying individuals at risk of developing AD.

Tailoring treatment in patients with Hodgkin lymphoma (HL) is paramount to maximize outcomes while avoiding unnecessary toxicity. We aimed to compare the performance of SUVmax reduction (ΔSUVmax%) versus Deauville score (DS) in assessing chemotherapy response in pediatric HL patients undergoing 18F-FDG PET-CT. Fifty-two patients with biopsy-proven HL (age 8-16 years) were enrolled at baseline, interim (after the 2nd or 3rd chemotherapy round), and post-therapy (upon completion of first-line chemotherapy) 18F-FDG PET-CT. Interim and post-therapy DS and ΔSUVmax% were compared as response predictors. Patients were classified as responders and non-responders based on 24-month clinical follow-up. Interim DS showed a sensitivity, specificity, positive predictive value (PPV), negative predictive value (NPV) and diagnostic accuracy of 100%, 80.4%, 100%, 40% and 82.7%, respectively in predicting response. Post-therapy DS showed a sensitivity, specificity, PPV, NPV and accuracy of 66.7%, 97.8%, 95.7%, 80% and 94.2%. Interim ΔSUVmax% showed a sensitivity, specificity, PPV, NPV and accuracy of 83.3%, 82.6%, 97.4%, 38.5% and 82.7%, with a 56.3% cutoff. Post-therapy ΔSUVmax% showed a sensitivity, specificity, PPV, NPV and accuracy of 83.3%, 84.8%, 97.5%, 41.7% and 84.6%, with a 76.8% cutoff. Sensitivity, specificity (p<0.05) and NPV (p<0.01) were significantly higher using DS than ΔSUVmax%. In conclusion, DS can predict chemotherapy response better than ΔSUVmax% in pediatric HL patients.

One of the most important problems in the presence of epidemics and pandemics is an accurate prediction and preparedness. Scholars and experts argue that future pandemics and/or epidemics are almost inevitable events and is not whether next pandemics will happen, but when a new heath emergency will emerge. Epidemiologic models for prediction of Coronavirus Disease 2019 (COVID-19) have shown many limitations because of unpredictable dynamics of the new viral agent SARS-CoV-2 in environment and society. The main goals of this study are twofold: first, the analysis of anthropogenic activities and factors that may trigger pandemic threats; second, the planning of new directions for strategies to reduce risks that a pandemic threat emerges and/or in the initial phase to reduce vast diffusion and negative impact of new viral agents that can generate hazards and problems in public health, environment and socioeconomic systems. In particular, the investigation and understanding of sources and driving factors concerning the emergence and diffusion of new pandemics have critical aspects for strategic actions of forecast, prevention and preparation of effective policy responses to cope with next pandemic crises and health emergencies. Insights here endeavor, whenever possible, to clarify these problems to increase the knowledge of the sources and factor determining the emergence of new viral agents in order to design optimal response policies to face next pandemic diseases similar to COVID-19. .

Quantitative biomarkers derived from positron-emission tomography/computed tomography (PET/CT) have been suggested as prognostic variables in immune-checkpoint inhibitor (ICI) treated non-small cell lung cancer (NSCLC). As such data for first-line ICI therapy and especially for chemotherapy-ICI combinations are still scarce, we retrospectively evaluated baseline 18F-FDG-PET/CT of 85 consecutive patients receiving first-line pembrolizumab with chemotherapy (n=70) or as monotherapy (n=15). Maximum and mean standardized uptake value, metabolic tumor volume (MTV), total lesion glycolysis and bone marrow-/ spleen to liver ratio (BLR/SLR) were calculated. Kaplan-Meier analyses and Cox-regression models were used to assess progression-free/overall survival (PFS/OS) and their determinant variables. Multivariate selection for PFS/OS revealed MTV as most relevant PET/CT biomarker (p<0.001). Median PFS/OS were significantly longer in patients with MTV≤70mL versus >70mL (PFS: 10 months (M; 95% confidence interval 4-16) vs. 4M (3-5), p=0.001; OS: not reached vs. 10M (5-15), p=0.004). Disease control rate was 81% vs. 53% for MTV≤/>70mL (p=0.007). BLR ≤1.06 versus >1.06 was associated with better outcomes (PFS: 8M (4-13) vs. 4M (3-6), p=0.034; OS: 19M (12-/) vs. 6M (4-12), p=0.005). In patients with MTV>70mL, concomitant BLR≤1.06 indicated a better prognosis. Higher MTV is associated with inferior PFS/OS in first-line ICI treated NSCLC, with BLR allowing additional risk stratification.

This study explores the integration of Artificial Intelligence (AI) and collaborative robotics in industrial surface finishing, focusing on feature detection on object reflective surfaces using neural networks in computationally constrained environments. Central to this investigation is the utilization of cameras considered as sensors that can capture detailed images of reflective surfaces. These images are then analyzed by a custom neural network, demonstrating the feasibility of feature detection with non-powerful computers. The public dataset for recognizing light reflection defects, available in the SPADD repository, supports this approach. Employing open-source tools like Darknet YOLOv3 and Yolo\_mark, this method proves particularly advantageous for small and medium-sized enterprises (SMEs) due to its low cost and maintenance requirements. This research highlights the challenges of AI and collaborative robotics in industrial applications, especially in adapting to varying conditions and the need for continuous training with new data coming from several sensors. Looking ahead, plans are in place to integrate this system with cobot-assisted polishing tasks, using cameras to enhance manufacturing efficiency and quality. This work contributes to the broader understanding of practical applications of AI in industrial automation, surface finishing processes, and the effective use of sensor technology.

In this paper, the problem of predicting future failure times based on a jointly type-II censored sample from k exponential populations is considered. The Bayesian prediction intervals and point predictors were then obtained. Generalized Bayes is a Bayesian study based on a learning-rate parameter. This study investigated the effects of the learning rate parameters on the prediction results. The loss functions of squared error, Linex, and general entropy were used as point predictors. Monte Carlo simulations were performed to show the effectiveness of the learning rate parameter in improving the results of prediction intervals and point predictors.

For the in-house validation of a droplet digital PCR method, a factorial experimental design was implemented. This design serves different purposes. On the one hand, it is an efficient design in relation to the workload involved in achieving a desirable level of reliability of variance estimates. On the other hand, it allows a partitioning of total variance into different components, thus providing information regarding the dominant sources of random variation. The statistical modelling reflects the actual measurement mechanism, establishing relationships between nominal target DNA copies per well, the range of variation of copy numbers per droplet, probability of detection values, and estimated numbers of copies.

The knowledge of what separates us genetically from our less-evolved relatives is crucial for gaining new biomedical insights about the human-chimpanzee relatedness for the use of appropriate stand-in towards the development of new treatments and diagnostic aids for various ailments. Although the genomes of humans and chimpanzees share 99% similarity, significant differences exist between the two species in their non-coding intronic regions. However, no work has been carried out in the aspects of target prediction concerning the ‘predicted homology’ in their microRNA sequences. Non-coding miRNAs which are post-transcriptional regulators of development, differentiation, growth, and metabolism, harboring the intronic regions may be crucial for expanding the horizons of our understanding. In this study, we proposed to perform the target prediction for the human-chimp miRNA homologs in the PHEX gene of the human X chromosome using various computational tools and databases. We identified a total of 1296 human miRNAs, 46, 957 gene targets, and 30, 563 targets of human and homologous chimp miRNAs respectively. Furthermore, we analysed gene interacting networks to identify the top interacting targets in both the species. Finally, we interpreted the biological importance of top-interacting miRNAs and their targets. The results demonstrated varying levels of multiplicity and cooperativity between the predicted miRNAs and target genes in the two genera. Such miRNAs may be responsible for the dysregulation of gene expression in several signaling pathways.

Increasingly, information technology facilitates the storage and management of data useful for risk analysis and event prediction. Studies on data extraction related to occupational health and safety are increasingly available; however, due to its variability, the construction sector warrants special attention. This review is conducted under the research programmes of the National Institute for Occupational Accident Insurance (Inail). Objectives: The research question focuses on identifying which data mining (DM) methods, among supervised, unsupervised, and others, are most appropriate to be applied to certain investigation objectives, types, and sources of data, as defined by the authors. Methods: Scopus and ProQuest were the main sources from which we extracted studies in the field of construction, published between 2014 and 2023. The eligibility criteria applied in the selection of studies, were based on the Preferred Reporting Items for Systematic Review and meta-analysis (PRISMA). For exploratory purposes, we applied hierarchical clustering, while for in-depth analysis, we use principal component analysis (PCA) and meta-analysis. Results: The search strategy based on the PRISMA eligibility criteria, provided us with 61 out of 2,234 potential articles, 202 observation, 91 methodologies, 4 survey purposes, 3 data sources, 7 data types, and 3 resource type. Cluster analysis and PCA organized the information included in the paper dataset into two dimensions and labels: "supervised methods, institutional dataset, and predictive and classificatory purposes" (correlation 0.97÷8.18E-01; p-value 7.67E-55÷1.28E-22) and the second, Dim2 "not-supervised methods; project, simulation, literature, text data; monitoring, decision-making processes; machinery and environment" (corr. 0.84÷0.47; p-value 5.79E-25÷3.59E-06). We answered the research question regarding which method, among supervised, unsupervised, or other, is most suitable for application to data in the construction industry. Conclusions: The meta-analysis provided an overall estimate of the better effectiveness of supervised methods (Odds Ratio = 0.71, Confidence Interval 0.53÷0.96) compared to not-supervised methods.

In the dynamic landscape of the telecommunications industry, understanding and mitigating customer churn is paramount for maintaining competitive advantage and sustaining revenue streams. This comprehensive literature review delves into the intricacies of customer churn prediction, a crucial aspect in fortifying the bond between telecom businesses and their customers. The review methodically analyzes 11 articles published between 2000 and March 2024, spotlighting the strategic role of Customer Relationship Management and the prevalence of high churn rates that necessitate a shift from customer acquisition to retention strategies. Furthermore, the review navigates through the challenges inherent in churn prediction, including the complexities of managing large, imbalanced, and noisy datasets and the intricacies involved in model selection and optimization. Despite these challenges, the paper highlights the superior capability of machine learning techniques in handling complex datasets to provide accurate predictions, albeit acknowledging their practical complexities. The main aim of the study is to provide an overview, serving as a knowledge base for researchers interested in machine learning techniques within the realm of telecommunications.

Accurate prediction of mercury content emitted from fossil-fueled power stations is of utmost importance for environmental pollution assessment and hazard mitigation. In this paper, mercury content in the output gas of power stations’ boilers was predicted using an adaptive neuro-fuzzy inference system (ANFIS) method integrated with particle swarm optimization (PSO). The input parameters of the model include coal characteristics and the operational parameters of the boilers. The dataset has been collected from 82 power plants and employed to educate and examine the proposed model. To evaluate the performance of the proposed hybrid model of ANFIS-PSO model, the statistical meter of MARE% was implemented, which resulted in 0.003266 and 0.013272 for training and testing, respectively. Furthermore, relative errors between acquired data and predicted values were between -0.25% and 0.1%, which confirm the accuracy of the model to deal nonlinearity and representing the dependency of flue gas mercury content into the specifications of coal and the boiler type.

In order to counter the impending shortage of skilled professionals in the aging societies of our time in many western countries such as Germany, solutions for business and society are urgently needed. Here, artificial intelligence (AI) can play an important role in mitigating the problem with the help of diverse applications. At the same time, it is important to consider both the needs of the respective employee1 and the company to ensure that the use of AI has a positive impact on the organization and finds social acceptance. In this article, we describe the newly developed OSQE model (Optimize, Secure, Qualify, Expand), which for the first time outlines an AI cycle against the shortage of skilled professionals in a holistic approach that focuses equally on people and companies. This can serve organizations as a guide for strategy development, decision-making for and implementation of AI-supported measures in an entire cycle of an employee's affiliation with a company. The model takes three driving forces into account: companies, professionals, and AI applications. In the model, the measures to be implemented are prioritized with ascending numbering based on what would be most urgent for a company to implement. All measures relate to areas of action that place people at the center and can be assigned to the classic cycle of belonging of an employee in the company. In this regard, the opportunities that AI offers to professionals and companies are highlighted.

The most extensive urban growths in the next 30 years are expected to occur in developing countries. Lagos, Nigeria - Africa’s second most populous megacity- is a prime example. To achieve more sustainable and resilient cities, there is a need for modeling the urban growth patterns of major cities and analyzing their implications. In this study, the urban growth of Lagos state was modeled using the Multi-Layer Perceptron (MLP) neural network for the transition modeling and the Markov Chain analysis for the change prediction, achieving a model accuracy of 81.8%. An innovative visual validation of the model results using the ArcGIS was combined with kappa correlation statistics. The results show that by 2031, built-up areas will be the most spatially extensive LULC class in the study area with percentage coverage of 34.1% as opposed to 9% in 1986. The coverage of bare areas is also expected to increase by 53% between 2016 and 2031. Conversely, 24.9% and 68.3% loss of forestlands and wetlands respectively, are expected between 2016 and 2031. In view of the 11^th goal of SDGs which focuses on achieving sustainable cities and communities, the objectives of African Union’s Agenda 2063, and based on the urban growth trends observed, the study recommends a prioritization of vertical expansion as opposed to the current horizontal urban growth trends in the study area.

The integration of Artificial Intelligence (AI) in dairy farm management through biometric facial recognition for cows is a significant stride in livestock management. This review critically evaluates the evolution, applications, and challenges of AI-driven biometric facial recognition in dairy farming. It emphasizes the role of this technology in enhancing individual monitoring of dairy cows, providing accurate health, behavior, and productivity tracking. Originally derived from human facial recognition systems, this approach utilizes distinctive bovine facial features for essential, non-invasive, real-time monitoring in large-scale operations. The progression of AI from elementary pattern recognition to advanced Convolutional Neural Networks (CNNs) and deep learning models marks a shift toward data-driven farming. This study addresses key challenges such as environmental variability, data collection hurdles, ethical concerns, and technological limitations. It also contrasts various AI models, spotlighting their unique strengths and practical utility in dairy farming scenarios. Despite these challenges, facial recognition technology holds promise for improving farm efficiency, animal welfare, and sustainable practices, highlighting the need for continuous research and development. The review concludes by advocating for future research focused on environmental adaptability, ethical AI application, cross-breed compatibility, and integration with other farming technologies. Ultimately, it underscores AI's transformative potential in modernizing dairy farming towards a more data-oriented, responsible agricultural future.

(1) Background: Transcription factors (TFs) are main regulators of eukaryotic gene expression. The cooperative binding of at least two TFs to genomic DNA is the widespread mechanism of transcription regulation. Massive analysis of co-occurrence of overrepresented pairs of motifs (composite elements, CEs) for different target TFs studied in ChIP-seq experiments can clarify the mechanisms of TF cooperation. (2) Methods: We focused on homotypic CEs representing the same motif models and considered only CEs with spacers. We improved the capability of the Motifs Co-Occurrence Tool (MCOT) to predict asymmetric homotypic CEs in which one of par-ticipating motifs has higher conservation than the other. We categorized the target TFs from the data of M. musculus ChIP-seq and A. thaliana ChIP-seq/DAP-seq according to the structure of DNA-binding domains (DBDs) into classes. (3) Results: For all TF classes the predominance of asymmetric CEs over both symmetric and those with no enrichment in both directions was re-vealed. Target TFs from classes Basic helix-loop-helix factors (bHLH) and Basic leucine zipper factors (bZIP) showed the highest fractions of datasets with asymmetric CEs. We showed that pioneer TFs, despite their DBD types, have a higher significance of asymmetry within homotyp-ic CEs compared to other TFs. (4) Conclusion: Asymmetry within homotypic CEs is a promising new feature decrypting the mechanisms of gene transcription regulation.

The main purpose of this study was to develop a model for predicting the quality of holes drilled in the root part of a spar of helicopter main rotor blades made of the Glass Fiber Reinforced Plastic (GFRP)-Ti multilayer polymer composite. As the main quality criterion, delaminations at the entry and exit of the drill from the hole were taken. In the experimental study a conventional drill and two modified geometry drills: a double-point angle drill and a dagger drill were used. Preliminary experiments showed the best hole quality when using modified drills, which allowed further detailed study only with both modified drills at different drilling speeds and feed rates. Its results in the form of training sets were used to build the Artificial Neural Networks (ANNs) to predict delamination at the entry and exit of drilled holes. The analysis of the fitted response functions, presented as 3D surfaces plots and superimposed contour plots, made it possible to choose the better tool - a double-point angle drill and determine the optimal area for drilling speed and feed rates, confirming that the prediction of the quality and productivity of machining composites based on ANN is an effective tool to search and quantify the quality criteria of such technologies.

Background: Open AI developed ChatGPT, a language model based on the GPT architecture, designed for text-based communication. Trained on diverse internet texts, ChatGPT generates contextually appropriate responses using machine learning. It understands input through analysis and context interpretation, generating coherent and contextually relevant responses. Interaction is possible through messaging platforms. Materials and Methods: In November 2023, we utilized ChatGPT 3.5, the default version at that time, to answer questions from the Italian National Residency Program Admission Tests (SSMs) of 2021, 2022, and 2023. The questions cover clinical, diagnostic, analytical, therapeutic, and epidemiological scenarios, sometimes accompanied by images. The study compared ChatGPT's answers to the official corrections on the Italian Ministry of University and Research (MUR) website. The scoring method used for evaluation was 1 point for correct answers, 0 points for unanswered questions, and -0.25 points for incorrect answers, reflecting the SSM test scoring system. Results: In summary, ChatGPT was tested with a total of 420 questions, 140 for each test. It achieved an overall accuracy of 80.48%, providing correct answers for 338 questions and incorrect answers for 82 questions. When faced with questions containing both text and images, it answered 55% correctly and 45% incorrectly. The model's performance varied over time, with an 82.14% accuracy rate in 2021 and 2022 (115 correct out of 140) and a 77.14% accuracy rate in 2023 (108 correct out of 140). Applying thisscoring method to the SSM test, ChatGPT would have scored 105 points in 2021 and 2022, and 100 points in 2023. Conclusions: ChatGPT has exhibited above-average performance in the last three SSM tests, highlighting its robust capability to interpret clinical scenarios and offer precise diagnostic and therapeutic guidance. Despite this, some limitations persist, notably the software's inability to interpret non-textual information.

Age-related diseases place an intense and growing stress on healthcare systems. Numerous theories of ageing exist. Yet prediction, prevention and treatment limitations of age-related disease persist because we lack a complete aetiological understanding of their origins. Here we propose a new theory that aims to provide a blueprint-type understanding of ageing and disease aetiology, working across multiple scientific disciplines. Supported by specific examples, we demonstrate that the primary driver of much of age-related diseases is the futile triggering of specific molecular pathways in a pathological manner, which we term patho-pathways. Patho-pathways induce pathological cell, tissue and system changes in the form of hyperactivity (undesirable increased and new biological activities that are typical of age related disease). As part of patho-pathways, all wild-type (normal) genes have the potential to contribute to age-related diseases (though specific risk varies and can be formularised). In a domino-style effect, one patho-pathway typically triggers others, resulting in complex, but traceable, cascades. Utility, in terms of changing clinical and scientific practice, is derived from mapping these cascades to create Blueprint Maps that allow identification of biomarkers and therapeutic targets far upstream in the causal chain of events. Finally, our theory provides testable hypotheses concerning predictions of links between otherwise seemingly disparate diseases as well as new interventions into ageing.

This article presents a comprehensive study on enhancing grid resilience through advanced forecasting and optimization techniques in the context of power outages. Power outages pose significant challenges to modern societies, affecting various sectors such as industries, households, and critical infrastructures. The research combines statistical analysis, machine learning algorithms, and optimization methods to address this issue to develop a holistic approach for predicting and mitigating power outage events. The proposed methodology involves the use of Monte Carlo simulations in MATLAB for future outage prediction, Long Short-Term Memory (LSTM) networks for forecasting solar irradiance and load profiles, and a hybrid LSTM-Particle Swarm Optimization (PSO) model to improve accuracy. Furthermore, the role of Battery State of Charge (SoC) in enhancing system resilience is explored. The study also assesses the techno-economic advantages of a grid-tied microgrid integrated with solar panels and batteries over conventional grid systems. The results highlight the potential of the proposed approach in strengthening grid resilience, reducing downtime, and fostering sustainable energy utilization.

For Visually impaired People (VIPs), the ability to convert text to sound can mean a new level of independence or the simple joy of a good book. With significant advances in Optical Character Recognition (OCR) in recent years, a number of reading aids are appearing on the market. These reading aids convert images captured by a camera to text which can then be read aloud. However, all of these reading aids suffer from a key issue – the user must be able to visually target the text and capture an image of sufficient quality for the OCR algorithm to function – no small task for VIPs. In this work, a Sound-Emitting Document Image Quality Assessment metric (SEDIQA) is proposed which allows the user to hear the quality of the text image and automatically captures the best image for OCR accuracy. This work also includes testing of OCR performance against image degradations, to identify the most significant contributors to accuracy reduction. The proposed No-Reference Image Quality Assessor (NR-IQA) is validated alongside established NR-IQAs and this work includes insights into the performance of these NR-IQAs on document images.

With the availability of wearable health monitoring sensor modules like 3-Lead Electrocardiogram (ECG), Pulse Oximeter (SpO2), Galvanic Skin Response (GSR), Hall effect sensor (for measuring Respiratory Rate), Blood Pressure and Temperature measuring and sensing elements, it has now become possible to device a composite health status monitoring kit that can measure vital signs and other physiological parameters pertaining to human health in real time. Traditionally, the physiological parameters along with vital signs related examination was possible only in a hospitalized or ambulatory environment, however due to advances in sensing and embedded system technology and miniaturization of data acquisition and processing elements health monitoring has become possible even when individuals remain engaged in their day to day activities at the convenience of space and location. The patients or individuals subject to monitoring may suffer from a traumatic experience due to their medical condition and may need emergent incidence response and the critical care team may have to prepare for the treatment only after the patient arrives, which often is too late, as in case of cardiac arrests or severe injuries. The research focused on real-time health status monitoring and trauma scoring using standard physiological parameters along with standard telemetry protocols to make the critical care team aware of an emergent situation and prepare for a medical emergency. Vital signs and physiological parameters (heart rate, temperature, respiratory rate, and blood pressure, SpO2) were measured in real time from human subjects non-invasively. In order to enable monitoring of the patients engaged in day to day activities, errors due to the motion were removed using stationary wavelet transform correction (correlation coefficient of 0.9 after correction) and signals from various sensors were denoised, filtered and were encoded in a format suitable for further data analysis. A composite sensor kit capable of monitoring vital signs and physiological parameters can be very useful in incident response when an individual undergoes a traumatic experience related to stroke, cardiac arrest, fits or even injury, as along with monitoring information the kit can calculate scores related to trauma like the Injury Severity Score (ISS), National Early Warning Signs (NEWS), Revised Trauma Score (RTS). Trauma Injury Severity Score (TRISS), Probability of Survival (Ps) score. An open access database of vital signs and physiological parameters from Physionet, MIMIC 2 Numerics (mimicdb/numerics) database was used to calculate NEWS and RTS and to generate correlation and regression models using the vital signs/physiological parameters for a clinical class of patients with respiratory failure and admitted to Intensive Care Unit (ICU). NEWS and RTS scores showed no significant correlation (r = 0.25, p<0.001) amongst themselves, however together NEWS and RTS showed significant correlation with Ps (blunt) (r = 0.70, p<0.001). RTS and Ps (blunt) scores showed some correlation (r = 0.63, p<0.001) and NEWS score showed significant correlation (r = 0.79, p<0.001) with Ps (blunt) scores. Furthermore, since individuals have to be monitored regardless of location, these kits have to have a built-in capability to locate the individual so that the incident response team can locate the individual based on Global Positioning System coordinates (GPS). A Quantum GIS (Geographical Information System) application using real-time GPS coordinates (OpenStreetMap coordinates) was used to calculate the shortest path using QGIS Network Analysis tool to demonstrate the calculation of shortest path and direction to locate the nearest service provider in shortest time. Along with locating the nearest healthcare service provider, it would help if the critical care team could be made aware of the physiological parameters and trauma scores using standard protocols accepted across the globe. The physiological parameters from the sensors along with the calculated trauma scores were encoded according to a standard Systematized Nomenclature of Medicine-Clinical Terms (SNOMED-CT) coding system and International Code of Diseases (ICD) codes and the trauma information was logged to Electronic Health Records (EHR) using Fast Health Interoperability Resources (FHIR) servers. FHIR servers provided interoperable web services to log the event information in real time. It could be concluded that analytical models trained on existing datasets can help in analyzing a traumatic experience or an injury and the information can be logged using a standard telemetry protocol as a telemedicine initiative. These scores enable the healthcare service providers to estimate the extent of trauma and prepare for medical emergency procedures and find applications in general and military healthcare.

The Model-View-Controller (MVC) architecture, a cornerstone of modern software engineering, offers a robust framework for developing dynamic user interfaces. This paper conducts a broad analysis of MVC’s deployment across various sectors, emphasizing its critical role in technological advancement and market integration. By examining implementation strategies in web development, mobile applications, and enterprise solutions, the study illustrates how MVC enhances application manageability, promotes efficient code reuse, and facilitates parallel development. The paper explores the adoption of MVC principles within major technologies such as Java, .NET, and JavaScript frameworks, underlining its widespread acceptance. Additionally, the analysis covers the preferential use of MVC frameworks within diverse market sectors including technology enterprises, educational institutions, e-commerce, and financial services, which leverage MVC for superior data management and user experience. Emerging trends such as the shift towards the Model-View-ViewModel (MVVM) architecture and the integration of MVC with artificial intelligence and machine learning technologies are also discussed. This comprehensive review not only reaffirms MVC’s enduring relevance but also its adaptive evolution in response to emerging technological demands and market needs.

One in 12 babies is born with a rare genetic disease. Sadly, most cases are undetected until later age, missing time for early treatment and opportunity to prevent complications. Humanity has entered a new era where Big Data collected by governments, including 2D and 3D facial scans, are available. Many rare genetic diseases can be identified by artificial intelligence (AI) analysis of the facial photo. Phenotyping AI utilizations facilitate comprehensive and accurate genetic evaluations. AI processing of this Big Data to identify rare genetic diseases could bring unimaginable benefits to healthcare, although this would be a questionable step in terms of citizen privacy and could lead to future "Orwellian" ramifications with government abuse. Going forward, a balance must be found between protecting the privacy of citizens and the enticing use of AI for their health risks and cost savings through prevention. The unimaginable potential of AI early diagnostics from facial photos also raises various ethical and legal concerns. This paper presents concept, protentional methods and legal and other limitations within EU legal framework in contrast with potential benefits. This paper is focused on AI utilization to early diagnostic of rare genetic diseases. Shift of paradigm in the screening for rare genetic diseases in population with AI face analysis is expected to have a significant impact. The potential of AI algorithms utilizations similar to face2gene app in general population or systematically on Big governmental datasets recording facial traits changes in time can have significant impact on public health but at the same time give raise to profound concern as violation of one’s privacy.

Digital technologies have changed the way supply chain operations are structured. In this article, we conduct systematic syntheses of literature on the impact of new technologies on supply chains and the related cyber risks. A taxonomic/cladistic approach is used for the evaluations of progress in the area of supply chain integration in the Industrial Internet of Things and Industry 4.0, with a specific focus on the mitigation of cyber risks. An analytical framework is presented, based on a critical assessment with respect to issues related to new types of cyber risk and the integration of supply chains with new technologies. This paper identifies a dynamic and self-adapting supply chain system supported with Artificial Intelligence and Machine Learning (AI/ML) and real-time intelligence for predictive cyber risk analytics. The system is integrated into a cognition engine that enables predictive cyber risk analytics with real-time intelligence from IoT networks at the edge. This enhances capacities and assist in the creation of a comprehensive understanding of the opportunities and threats that arise when edge computing nodes are deployed, and when AI/ML technologies are migrated to the periphery of IoT networks.

Paving blocks are concrete pieces placed in exposed places to the weather, which are sub-jected to loads and wear. Hence, quality control in the manufacture of paving blocks is es-sential to guarantee the properties and durability of the product in construction projects. In Ecuador, the requirements are described in the Ecuadorian technical standard "NTE INEN 3040", and tensile splitting strength is a fundamental requirement to guarantee product quality. It is analyzed using quality control measurements such as dimensions, the weight of the fresh paving block in the vibro-compacted process, and the percentage of water absorption in order to know how the variables influence and manage to predict the tensile splitting strength to avoid product non-conformity in advance, having a timely and better control of the manufacturing process. The data was obtained from a company that can produce 30 000 units per day of rectangular paving blocks with 6 cm thickness. Mul-tivariate models such as multiple linear regression, regression trees, random forests and neural networks are performed to predict the tensile splitting strength variable through two groups of predictors; the first group is the thickness mm, width mm, length mm, mass of fresh paving block g and percentage of water absorption %. The second group of pre-dictor variables is the density of the fresh paving block kg/m3 and the percentage of water absorption %. It is concluded that the multiple linear regression method performs better in predicting the first group of predictor variables with a mean square error (MSE) of 0.110086, followed by the neural network without hidden layers resulting in an MSE of 0.112198. The best method for the second set of predictors was the neural network with-out hidden layers with a mean square error ( MSE ) of 0.112402, closely followed by the multiple linear regression model with an MSE of 0.115044.

Camptothecin (CPT) is a potent anticancer drug, and its putative oral administration is envisioned although difficult due to physiological barriers that must be overcome. A comprehensive biophysical analysis of CPT interaction with biointerface models can be used to predict some pharmacokinetic issues after oral administration of this or other drugs. To that end, different models were used to mimic the phospholipid composition of normal, cancer, and blood-brain barrier endothelial cell membranes. The logD values obtained indicate that the drug is well distributed across membranes. CPT-membrane interaction studies also confirm the drug’s location at the membrane cooperative and interfacial regions. The drug can also permeate membranes at more ordered phases by altering phospholipid packing. The similar logD values obtained in membrane models mimicking cancer or normal cells imply that CPT has limited selectivity to its target. Furthermore, CPT binds strongly to serum albumin, leaving only 8.05% of free drug available to be distributed to the tissues. The strong interaction with plasma proteins, allied to the large distribution (VDSS=5.75 ± 0.932 L·Kg-1) and tendency to bioaccumulate in off-target tissues, were predicted to be pharmacokinetic issues of CPT, implying the need to develop drug delivery systems to improve its biodistribution.

Following the coronavirus disease 2019 (COVID-19) pandemic, several studies have examined the possibility of correlating the virulence of severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2), the virus that causes COVID-19, to the climatic conditions of the involved sites; however, inconclusive results have been generally obtained. Although either air temperature or humidity cannot be independently correlated with virus viability, a strong relationship between SARS-CoV-2 virulence and the specific enthalpy of moist air appears to exist, as confirmed by extensive data analysis. Given this framework, the present study involves a detailed investigation based on the first 20–30 days of the epidemic before public health interventions in 30 selected Italian provinces with rather different climates, here assumed as being representative of what happened in the country from North to South, of the relationship between COVID-19 distributions and the climatic conditions recorded at each site before the pandemic outbreak. Accordingly, a correlating equation between the incidence rate of the pandemic and the average specific enthalpy of atmospheric air was developed, and an enthalpy-based seasonal virulence risk scale was proposed as a tool to predict the potential danger of COVID-19 spread due to the persistence of weather conditions favorable to SARS-CoV-2 viability. For practical applications, a conclusive risk chart expressed in terms of coupled temperatures and relative humidity (RH) values was provided, showing that safer conditions occur in case of higher RH at the highest temperatures, and of lower RH at the lowest temperatures. The proposed risk scale was in agreement with the available infectivity data in the literature for a number of cities around the world.

Pathogenicity is unknown for the majority of human gene variants. For prioritization of sequenced somatic and germline mutation variants, in silico approaches can be utilized. In this study, 84 million non-synonymous Single Nucleotide Variants (SNVs) in the human coding genome were annotated using consensus Variant Effect Prediction (cVEP) method. An algorithm, implemented as a stacked ensemble of supervised learners, performed combination of the 39 functional, conservation mutation impact scores from dbNSFP4.0. Adding gene indispensability score, accounting for differences in the pathogenicities of the variants in the essential and the mutation-tolerant genes, improved the predictions. For each SNV the consensus combination gives either a continuous-value pathogenicity score, or a categorical score in five classes: pathogenic, likely pathogenic, uncertain significance, likely benign, benign. The provided class database is aimed for direct use in clinical practice. The trained prediction models were 5-fold cross-validated on the evidence-based categorical annotations from the ClinVar database. The rankings of the scores based on their ability to predict pathogenicity were obtained. A two-step strategy using the rankings, scores and class annotations is suggested for filtering and prioritization of the human exome mutations in clinical and biological applications of NGS technology.

Predatory research field in science is when an emerging scientific topic destroys current topics and characterizes a main scientific change. Predatory research field can be a basic driver of scientific and technological change that generates a 'creative destruction' in science and society in contexts of knowledge-based competition and rapid changes. The prediction of proposed theory of predatory research fields is that it destroys with a fast growth other research fields. The theoretical approach is tested here in research fields of large language models (LLM) by analyzing the transformers (a deep learning architecture based on the multi-head attention mechanism) proposed in 2017 and from November 2022 started main applications in generative artificial intelligence with innovations of BERT, ChatGPT, Microsoft Copilot (launched on February 7, 2023) and other natural language processing tools driven by AI technology for engaging conversations, gain insights, automate tasks, etc., etc. Statistical evidence suggests that growth rate of transformer technologies is 80.58%, a high level compared to all other research fields in machine learning (having a growth rate of 13.83%). Moreover, predatory research field of transformers has a destructive power such that all other domains in LLM from 2021 to 2023 have a general reduction of scientific growth. The impact of transformers is much more drastic of previous radical technologies such as CNN having a temporal growth rate of 0.16%, lower than 0.38% by transformers, ceteris paribus. These analysis reveals that transformers have characteristics to generate a radical scientific and technological change in a not-too-distant future. Overall, then, the study suggests that predatory research field on emerging topics and technologies can generate path-breaking innovations and the examination here can clarify the essential elements of the science dynamics for a better theory of scientific and technological change, providing also main implications for knowledge policy to support promising research fields and technologies to guide economic and social change.

As the telecommunications landscape braces for the post-5G era, this paper embarks on delineating the foundational pillars and pioneering visions that define the trajectory towards 6G wireless communication systems. Recognizing the insatiable demand for higher data rates, enhanced connectivity, and broader network coverage, we unravel the evolution from the existing 5G infrastructure to the nascent 6G framework, setting the stage for transformative advancements anticipated in the 2030s. Our discourse navigates through the intricate architecture of 6G, highlighting the paradigm shifts towards super convergence, non-IP-based networking protocols, and information-centric net-works, all underpinned by a robust 360-degree cybersecurity and privacy-by-engineering design. Delving into the core of 6G, we articulate a systematic exploration of the key technologies earmarked to revolutionize wireless communication including terahertz (THz) waves, optical wireless technology, and dynamic spectrum management,while elucidating the intricate tradeoffs necessitated by the integration of such innovations. This paper not only lays out a comprehensive 6G vision accentuated by high security, affordability, and intelligence but also charts the course for addressing the pivotal challenges of spectrum efficiency, energy consumption, and the seamless integration of emerging technologies. In this study, our goal is to enrich the existing discussions and research efforts by providing comprehen-sive insights into the development of 6G technology, ultimately supporting the creation of a thoroughly connected future world that meets evolving demands.