The effect of wave forces on the structural safety of fixed oscillating water-column (OWC) devices is critical. In this study, a three-dimensional numerical model of an oscillating water column (OWC) device is constructed using the computational fluid dynamics software OpenFOAM. Subsequently, the hydrodynamic performance of the numerical model is comprehensively validated. Finally, the hydrodynamic performance data are analyzed in detail to obtain meaningful conclusions. The results indicate that the horizontal wave force on the OWC device is approximately 6.6 to 7.9 times greater than the vertical wave force, whereas the lateral wave force is relatively small. Both the horizontal and vertical wave forces decrease as the relative water depth increases under a constant wave period and height. The horizontal wave force increases linearly with the wave height, whereas the vertical wave force increases with the square of the wave height. In addition, the highest dynamic water pressure is observed at the interface between the water surface and device, both within and outside the front wall of the gas chamber. The dynamic water pressure at different locations on the front chamber increases and subsequently decreases as the wave frequency increases.

Coseismic landslides have the potential to cause catastrophic disasters. Thus, it is of crucial importance to conduct a comprehensive regional assessment of susceptibility to coseismic landslides. This study rigorously interprets 13,759 coseismic landslides triggered by the 2022 Luding earthquake within the seismic zone. Employing the Newmark method, we systematically assess the susceptibility to coseismic landslides through the application of six distinct displacement regression models. The efficacy of these models is validated against the actual landslide inventory using the area under the curve. A hazard map of coseismic landslides is generated based on the displacement regression model with the highest degree of fit. The results show that Moxi Town, Detuo Town, the flanks of the Daduhe River, Wandonghe River, Hailuogou River, and Yanzigou River are high susceptibility areas for coseismic landslides. The study explores factors influencing model fit, revealing that the inclusion of both epicentral distance and the distance to seismogenic fault and in displacement prediction enhances model performance. Nevertheless, in close proximity to fault zones, the distance to seismogenic fault exerts a more significant influence on the spatial distribution density of coseismic landslides compared to the epicentral distance. Conversely, in regions situated further from fault zones, the epicentral distance has a greater impact on the spatial distribution density of coseismic landslides compared to the distance to seismogenic fault. These findings contribute to a nuanced understanding of coseismic landslide susceptibility and offer valuable insights for future Newmark method-based coseismic landslide displacement calculations.

In an effort to enhance the efficiency and safety of open-pit mines, this study explores the optimization of end slope road parameters and slope structures, specifically focusing on unmanned driving lanes.A significant aspect of the study is the development of a truck trajectory offset model, which considers the different reaction times between automated sensors and human drivers in adapting to environmental changes. To test these concepts, the study uses numerical simulations to confirm the stability of the proposed end slope designs. Using Victory West Mine No. 1 as a case study, the research determines the optimized width for unmanned driving lanes and the maximum angle for safe steepening of end slopes. The findings indicate that the optimized unmanned lane width for NTE240 mining dump trucks is 1743 mm, allowing for a 2-degree increase in the slope angle at the south end slope. This optimization leads to a steep mining stripping volume of 3.2735 million m³ and a coal output of 2.49628 million tons, maintaining a stripping ratio of 1.31m³/t. These results demonstrate that the unmanned driving road width optimization not only ensures slope safety but also significantly boosts the economic benefits of steep mining in open-pit mines.

In this study, a new structure is proposed based on the body-centered cubic (BCC) lattice structure: adding a cubic truss in the center of the BCC structure, which is denoted by TLC (Truss-lattice-cube). The different dimensions of the central cube can affect the mechanical properties of the lattice structure notably. With a fixed length (15mm) of a unit cell, the optimal size for the central cube is determined to be 5 mm. Quasi-static compressive tests are performed on specimens made of Polylactic Acid (PLA) using additive manufacturing technology. The deformation characteristics of the new structure is analyzed in detail by experiments and numerical simulations. Compared to the BCC structure, the mechanical properties of the TLC structure are significantly improved. The initial flow stress of the TLC has been increased by 122% at a strain of 0.1; the specific strength has been enhanced by 293% at a strain of 0.5; and the specific energy absorption has been improved by 312% at the strain of 0.6. Printing defects in the lattice structure could deteriorate the mechanical property remarkably. In this work, incorporation of microcracks into the finite element model makes the simulation capture the influence of printing defects and improve the predictive accuracy of simulation significantly.

This study derives space travel pricing by Walrasian Equilibrium, which is logical reasoning from the general relativity theory (GRT), the accounting equation, and economic supply and demand functions. The Cobb-Douglas functions embed the endogenous space factor as new capital to form the space travel firm's production function, which is also transformed into the consumer's utility function. Thus, the market equilibrium occurs at the equivalence of supply and demand functions, like the GRT presents the equivalence between the spatial geometric tensor and the energy-momentum tensor, which explains the principles of gravity and the motion of space matter in the spacetime framework. The mathematical axiomatic set theory of the accounting equation explains the equity premium effect that causes a short-term accounting equation inequality, then reaches the equivalence by suppliers' incremental equity through the closing accounts process of the accounting cycle. On the demand side, the consumption of space travel can be assumed as a value at risk (VaR) investment to attain the specific spacetime curvature in an expected orbit. Spacetime market equilibrium is then achieved to construct the space travel pricing model. The methodology of econophysics and analogy method was applied to infer the space travel pricing by the model of profit maximization, single-minded, and envy-free pricing in unit-demand markets. A case study with simulation was conducted for empirical verification of the math models and algorithm. Results show that space travel pricing remains the principle of market equilibrium but needs to be extended to the spacetime tensor of GRT.

Detecting rotated objects in remote sensing images poses a substantial challenge. These images usually cover a wide field of view, containing diverse and complex backgrounds with variously sized ground objects densely distributed. Therefore, identifying objects of interest in remote-sensing images is challenging. While integrating Convolutional Neural Networks (CNNs) and Transformer networks has exhibited progress in detecting rotated objects, there is still scope for enhancing feature extraction and fusion. To address this issue, we propose a feature extraction module, a feature context aggregation module, and a multi-scale feature fusion module. Initially, we substitute the Spatial Pyramid Pooling Bottleneck (SPPFBottleneck) with a new module aimed at extracting multi-scale features, thereby enhancing the detection of small objects in complex backgrounds. Next, we develop a novel module for the multi-scale fusion of contextual information within feature maps, extracting valuable information. Finally, we combine the original features with the fused ones to prevent the loss of specific features in the fusion process. We refer to our newly proposed model as the "Multi-scale Feature Context Aggregation Network" (MFCANet). We assess our approach on three challenging remote sensing datasets: MAR20, SRSDD, and HRSC. Comprehensive experimental results show that our method surpasses baseline models by 2.13%, 10.28%, and 1.46% mAP on the MAR20, SRSDD, and HRSC datasets, respectively.

Space tourism began in 2001 and became popular in 2021 because of commercial operations. With the development of space technology and commercialization, like re-launchable rockets to travel to space in recent years, it has gradually entered the era of space. However, the space industry causes massive emissions, inducing some opposition to its development. It is essential to investigate the attitude of residents toward space tourism and balance the pros and cons of sustainability. Quantitative analysis was adapted to test two models based on duality theory. The data were obtained from 284 samples from various regions of China and analyzed using the partial least squares structural equation modeling (PLS-SEM). The results show that the two-factor model of economic development conflicted with environmental protection. However, study two indicates that educational interventions can facilitate sustainable space tourism because they mediate the relationship between economic and environmental factors.

During the hand-eye calibration process of the manipulator, the Euclidean distance error of the calibration results cannot be calculated because the true values of the hand-eye conversion matrix cannot be obtained. In this paper, a new method of projection error analysis is presented. Error analysis is carried out by using a priori knowledge that the location of AR markers is fixed in the calibration process. The coordinates of the AR marker center point are reprojected to the pixel coordinate system, and then compared with the true pixel coordinates of the AR marker center point obtained by corner detection or manual labeling in order to obtain the Euclidean distance between the two coordinates as the basis for error analysis. Experimental results show that the proposed optimization method can greatly improve the accuracy of hand-eye calibration results.

Detecting rotational objects in remote sensing imagery is a significant challenge. These images typically encompass a broad field of view, featuring diverse and intricate backgrounds, with ground objects of various sizes densely scattered. As a result, identifying objects of interest within these images is a daunting task. While the integration of Convolutional Neural Networks (CNN) and Transformer networks leads to some advancements in rotational object detection, there is still room for improvement, particularly in enhancing the extraction and utilization of information related to smaller objects. To address this, our paper presents a multi-scale feature fusion module and a global feature context aggregation module. Initially, we fuse original, shallow, and deep features to reduce the loss of shallow feature information, thereby improving the detection performance of small objects in complex backgrounds. Subsequently, we compute the correlation of contextual information within feature maps to extract valuable insights. We name the newly proposed model the "Multiscale Feature Context Aggregation Module" (MFCA). We evaluate our proposed methodology on three challenging remote sensing datasets: DIOR-R, HRSC, and MAR20. Comprehensive experimental results show that our approach surpasses baseline models by 2.07\% mAP, 1.02\% mAP, and 1.98\% mAP on the DIOR-R, HRSC2016, and MAR20 datasets, respectively.

Environmentally friendly lead-free K1-xNaxNbO3 (KNN) ceramics possess electromechanical properties comparable to lead-based ferroelectric materials, but cannot meet the needs of device miniaturization, and the corresponding thin films lack of theoretical and experimental studies. To this end, we developed the nonlinear phenomenological theory for ferroelectric materials to study the effects of non-equiaxed misfit strain on the phase structure, electromechanical properties and electrical response of K0.5Na0.5NbO3 epitaxial films and constructed the in-plane misfit strain (u1-u2) phase diagrams. The results show that K0.5Na0.5NbO3 epitaxial film under non-equiaxed in-plane strain can exhibit abundant phase structures, including orthorhombic a1c, a2c and a1a2 phases, tetragonal a1, a2 and c phases, and monoclinic r12 phases. Moreover, in the vicinity of a2c-r12, a1c-c and a1a2-a2 phase boundaries, K0.5Na0.5NbO3 epitaxial films exhibit excellent dielectric constant ε11, while at a2c -r12 and a1c-c phase boundaries large piezoelectric coefficient d15 is observed. It was also found that high permittivity ε33 and piezoelectric coefficients d33 exist near the a2c - a2, r12- a1a2 and a1c-a1 phase boundaries due to the existence of polymorphic phase boundaries (PPB) in the KNN system, which makes it easy to polarize near the phase boundaries, and the polarizability changes suddenly, leading to electromechanical enhancement. In addition, the results show that the K0.5Na0.5NbO3 thin films possess a large electrocaloric response at the phase boundary at the r12-a1a2 and a1c-a1 phase boundaries. And the maximum adiabatic temperature change ∆T is about 3.62 K when the electric field change is 30 MV/m at room temperature, which is significantly enhanced compared with equiaxed strain. This study provides theoretical guidance for obtaining K1-xNaxNbO3 epitaxial thin films with excellent properties.

Today’s intruders usually send attacking commands to a target system through several stepping-stone hosts, in order to reduce the chance of being detected. With stepping-stone intrusion (SSI), the intruder’s identity is hidden behind a long interactive chain of hosts and very hard to detect. An effective approach for SSI detection (SSID) is to estimate the length of the chain. This type of method is called network-based SSID. Most existing network-based SSID worked effectively only when intruders’ session manipulation was not present. These known SSID algorithms are either weak to resist intruders’ chaff-perturbation manipulation or having very limited capability in resisting attacker’s session manipulation. This paper develops a novel network-based SSID algorithm resistant to intruders’ chaff-perturbation by using packet crossover. Our proposed SSID algorithm is simple and easy to implement as the number of packet crossovers can be easily computed. We conduct rigorous technical proofs to verify the correctness of our proposed algorithm. The experimental results show that our proposed SSID algorithm works effectively and perfectly in resisting intruders’ chaff-perturbation up to 50% chaff rate.

More than fifty million people over the age of fifty have osteoporosis issues due to low bone mass, disease contribution, and not exercising continuously. Certain most important risk factors and causes of osteoporosis contain age, gender, hormones, visits to inexperienced doctors, and certain medical conditions. In this manuscript, we diagnosed certain frank operational laws under the availability of complex intuitionistic fuzzy (CIF) information. Furthermore, using the evaluated operational laws, we pioneered the theory of CIF frank weighted averaging (CIFFWA), CIF frank ordered weighted averaging (CIFFOWA), CIF frank hybrid averaging (CIFFHA), CIF frank weighted geometric (CIFFWG), CIF frank ordered weighted geometric (CIFFOWG), CIF frank hybrid geometric (CIFFHG) operators, and described their beneficial and valuable results with certain useful properties. Moreover, we aim to evaluate the most dangerous type of osteoporosis based on their symptoms, causes, and risk factors using diagnosed approaches. Finally, to enhance the worth of the evaluated operators, we compare the diagnosed result with certain prevailing results and illustrated their geometrical representation with the help of MATLAB.

Fiber distributed optical fiber acoustic sensor (DAS) is generally used in distributed long-distance acoustic/vibration measurement. We found that DAS with excellent performance of low self-noise and anti-fading in combination with the plastic structure in daily life as an acoustic transducer can achieve high-sensitivity acoustic measurement at a single point rather than designing a state-of-the-art acoustic transducer or using special enhanced scattering fiber. The simple acoustic transducer we proposed for DAS can reach the sensitivity level of -106.5dB re. 1rad/μPa at a sensing range of 5.1 km, which can meet many demands on the industrial site.

The therapeutic effects of volatile anesthetics on mental diseases, particularly schizophrenia, have gained considerable interest. Although isoflurane is a commonly used volatile anesthetic, there’s no more evidence that it could work on treating schizophrenia. Here, we discovered that inhaling isoflurane at low concentrations might reverse the behavioral phenotypes of schizophrenia caused by MK801, such as hyperlocomotion, pre-pulse inhibition impairment, and working memory loss. Isoflurane also helped recovering adult neurogenesis and synaptic plasticity impairments in the dentate gyrus (DG) induced by MK801. To better understand the mechanism, we discovered that isoflurane could reverse the reduction of parvalbumin (PV)-positive GABAergic interneuron (PVI) number and the aberration of NRG1-ErbB4 signaling in the DG; however, isoflurane could not reverse the schizophrenia-related phenotypes caused by PVI ablation, indicating that PVI are necessary for the therapeutic effect of isoflurane. Interestingly, isoflurane could reverse phenotypes caused by blocking PVIs GABA release in the DG, indicating the therapeutic impact is independent of PVI GABA release. Our research revealed that isoflurane might be used to treat schizophrenia, possibly through PVI in the DG.

Chronic diseases (e.g., heart disease, cancer, diabetes) are of major public concern. Such chronic diseases are often caused by a dietary pattern characterized as relatively high in fat, refined sugar, salt, and cholesterol. Societal interest in consuming healthy foods and the demand for healthy food products has increased significantly. As a result, functional foods have gained significant research attention in the food health and technology innovations field. To date, many studies have investigated the factors that may predict consumer acceptance of functional foods, and a wide range of influential factors have been reported. However, studies conducted in different contexts pose challenges to gaining a clear understanding of the factors influencing consumer acceptance. This scoping review identified 75 articles published with varying populations around the globe that empirically investigated consumers’ acceptance of functional foods. We identified and categorized a wide range of determinants related to consumer acceptance of different types of functional foods. The five categories of determinants were product characteristics, socio-demographic characteristics, psychological characteristics, behavioral characteristics, and physical characteristics. Each of the determinants were more fully described by sub-determinants in our scoping review. These determinants should be considered and used by leaders and scientists in product development to aid decision making and, ultimately, the successful launch of novel functional foods.

Moral identity can promote people’s well-being, but existing research has paid little attention to the mechanism of the link between the two. The current study proposed that the eudaimonic identity function is a critical mechanism that links moral identity and well-being. Specifically, the quality of identity commitment mediates the link between subjective well-being and the two dimensions of moral identity, namely, internalization and symbolization. We examined these hypotheses in 419 participants, who completed the Self-importance of Moral Identity Questionnaire, Satisfaction with Life Scale, Scale of Positive and Negative Experience, and Questionnaire for Eudaimonic Well-being. Results from the obtained data confirmed our hypotheses: There is a significant correlation between moral identity and subjective well-being. Both the internalization and symbolization dimensions of moral identity promote subjective well-being through the mediating role of identity commitment quality. We discussed these findings with respect to implications and proposed research suggestions for future studies.

The COVID-19 pandemic caused by SARS-CoV-2 poses a devastating threat to human society in terms of health, economy and lifestyle. Establishing accurate and real-time models to predict and assess the impact of the epidemic on the economy is instructive. We have designed a new model to quantitatively assess the impact of the COVID-19 on the economy of China’s mainland. The nominal GDP in the Q1 of 2020 that we predicted for China’s mainland with the Baidu Mi-gration Data is RMB 20,785.7 billion, which is less by 3.59% than that in 2019. The estimated val-ue is confirmed roughly by the official report released in April 17, 2020 (RMB 20,650 billion, 6.8% year-on-year declined). Strict control measures during the epidemic have greatly reduced Chi-na's economic activity and had a serious impact on the country's economy. Orderly promotion of population mobility plays a decisive role in economic recovery.

This paper studies the integrated design problems of control and guidance with parameter uncertainties, target disturbances, input constraints and actuator faults. Firstly, based on the integrated design idea of the missile guidance and control, the auxiliary variable is used to establish and transform it into a cascade system with input constraints, actuator faults and disturbances of unknown upper bounds. Secondly, the adaptive anti-saturation dynamic surface fault-tolerant controller is designed by using the back-stepping method, adaptive control, auxiliary system and tracking differentiator. By introducing the tracking differentiator and tangent barrier Lyapunov function, the computational explosion problem in the traditional back-stepping method is avoided and the angle of attack can be guaranteed in prospective range, respectively. Finally, the theoretical proof of the designed control strategy is given to ensure that the states of the closed-loop system are bounded. At the same time, the digital simulation of the maneuvering target of different maneuvering forms is carried out, which further illustrate the effectiveness and robustness of the designed control schemes.

The infected and fatal cases of Coronavirus Disease 2019 (COVID-19) keep increasing around the world, to explore the infection routes and pathogenesis of 2019-nCoV could be meaningful for prevention and treatment of COVID-19. Previous studies showed that the oral cavity is at potentially high risk of 2019-nCoV infection. The ACE2 receptor of 2019-nCoV was reported could express on oral epithelium and salivary glands, and 2019-nCoV could be detected in patients’ saliva. Recently, the amblygeustia were found to widely exist in the COVID-19 patients. To explore the potential mechanism of amblygeustia, we performed further analysis via independent in-house single-cell profiles. Our results showed that ACE2 was inclined to express in taste cells, which indicated that 2019-nCoV may invade into taste cells at the early stage of COVID-19, and lead to the amblygeustia of patients. Above findings about the 2019-nCoV and COVID-19 in oral cavity are valuable and enlightening for future epidemic prevention strategy.

HybridAC/DC microgrids(HMG) are emerging as an attracting method for integrating the AC/DC distributed energy resources(DERs) with the features of high-performance and low-cost. In the isolated hybrid AC/DC microgrid (IHMG), the key problem is how to balance the power variation and regulate the voltage and frequency. Various energy storage systems (ESS)and interlinking converter (IC) technologies are viable for this application. The present study proposes a novel unified power flow model to evaluate and compare the abilities of the ESS with different connection topologies and ICs with different control approaches to maintain the voltage and frequency stability of the IHMG. In order to investigate the performance of the proposed scheme, five operation modes of the IHMG are defined and explained. The classification is based on the connection topologies and control modes of the ESS/IC in the IHMG. Then, a set of generic PF equations are derived. Moreover, three binary matrices are applied in the construction of the unified power equations. These matrices are used for describing the running state of the IHMG. Finally, in order to verify the proposed scheme, it is applied to several case studies of the IHMG. The operation characteristics of multi-DC subgrids IHMG in different modes, particularly when an external disturbance occurs, are investigated.

Trailing oil is the tail section of contamination. There are two main reasons for the formation of trailing oil, one is the effect of laminar flow boundary layer, the other is the outflow of the preceding batch remained in the dead-legs. In the batch transportation of refined oil, under the action of viscous force, the preceding batch forms laminar boundary layer near the pipe wall and stays on the pipe wall, resulting in the phenomenon of contamination trailing and formation of trailing oil. When oil passes through the valve chamber of the oil transportation station, dead-leg will be formed. Due to gravity and convection diffusion, preceding batch flowing from dead-legs will form trailing oil in the pipeline. The phenomenon of trailing oil exists in the process of batch transportation, which will have an effect on the quality of oil. In this paper, Reynolds time-averaged method is used to simulate turbulence.Computational Fluid Dynamics(CFD) software is used to simulate different flow rates and bypass lengths to obtain contamination-related experimental data.Matlab software is used to perform multi-nonlinear regression for the oil substitution time, the length of the bypass and the flow rate. The formula for calculating the length of the trailing oil produced by the dead-leg is obtained. The modified formula for calculating the length of the contamination is obtained by combining the existing formula for calculating the length of the contamination.

This paper focuses on the integrated guidance and autopilot design with control input saturation in the end-game phase of hypersonic flight. Firstly, uncertain nonlinear integrated guidance and autopilot model is developed with third actuator dynamics, where the control surface deflection has magnitude constraint. Secondly, neural network is implemented in extended state observer (ESO) design, which is used to estimate the complex model uncertainty, nonlinearity and state coupling. Thirdly, a command filtered back-stepping controller is designed with hybrid sliding surfaces to improve the terminal performance. In the process, different command filters are implemented to avoid the influences of disturbances and repetitive derivation, meanwhile solve the problem of unknown control direction caused by saturation. The stability of closed-loop system is proved by Lyapunov theory, and the principles abided by the controller parameters are concluded through the proof. Finally, series of 6-DOF numerical simulations are presented to show the feasibility and validity of the proposed controller.

We demonstrated an ITO-free, highly transparent organic solar cell with the potential to be integrated into window panes for energy harvesting purposes. A transparent, conductive ZnO/Ag/ZnO multilayer electrode and a Ag:Ca thin film electrode were used in this transparent device as the bottom and top electrode, respectively. To further improve the transmittance of the solar cell, the thickness of the top ZnO layer was investigated by both experiment and simulation. An average visible transmittance of > 60% was reached, with a maximum transmittance of 73% at 556 nm. Both top and bottom illumination of the solar cell generated comparable power conversion efficiencies, which indicates the wide application of this solar cell structure. In addition, we fabricated distributed Bragg reflector mirrors with sputtered SiO2 and TiO2, which efficiently increased the power conversion efficiency over 20% for the solar cells on glass and PET substrates,

Microscopic and ultra-microscopic vascular sutures are indispensable in the surgical procedures such as arm transplantation and finger reattachment. The state of the blood vessels after suturing, such as vascular patency, narrow, and blocked, determines the success rate of the operation. If we can grasp the golden window period after blood vessel suture and before muscle tissue suture to achieve accurate and objective assessment of blood vessel status, it can not only reduce medical costs but also improve social benefits. Doppler optical coherence tomography enables high-speed, high-resolution imaging of biological tissues, especially microscopic and ultra-microscopic blood vessels. Using Doppler optical coherence tomography to image the sutured blood vessels, not only the three-dimensional structure of the blood vessels, but also the blood flow information can be obtained. By extracting the contour of blood vessel wall and the contour of blood flow area, the three-dimensional shape of blood vessel can be reconstructed in three dimensions, which provides parameter support for the assessment of blood vessel status. In this work, we propose a neural network-based multi-classification deep learning model that can simultaneously and automatically extract blood vessel boundaries from Doppler OCT vessel intensity images and the contours of blood flow regions from corresponding Doppler OCT vessel phase images. Compared with the traditional random walk segmentation algorithm and cascade neural network method, the proposed model has better performance. This method is easier to realize system integration and has great potential for clinical evaluation. It is expected to be applied to the evaluation of microscopic and ultra-microscopic vascular status in microvascular anastomosis.

Federated learning is an effective approach for preserving data privacy and security, enabling machine learning to occur in a distributed environment and promoting its development. However, an urgent problem that needs to be addressed is how to encourage active client participation in federated learning. The Shapley Value, a classical concept in cooperative game theory, has been utilized for data valuation in machine learning services. Nevertheless, existing numerical evaluation schemes based on the Shapley Value are impractical as they necessitate additional model training, leading to increased communication overhead. Moreover, participants’ data may exhibit Non-IID characteristics, posing a significant challenge to evaluating participant contributions. Non-IID data weakens the marginal effects of participants, which in turn affects model accuracy and leads to underestimated contribution measurements. Current works often overlook the impact of heterogeneity on model aggregation. This paper presents a fair federated learning contribution measurement scheme that addresses the need for additional model computations. By introducing a noval aggregation weight, it enhances the accuracy of contribution measurement. Experiments on the MNIST dataset show that the proposed method can accurately compute the contributions of participants. Compared to existing baseline algorithms, the model accuracy is significantly improved, with a similar time cost.

Abstract: Dispersal strategies of a species can affect its invasion success. Investigation into the dispersal strategies of invasive species in relation to different factors helps our understanding of the invasion mechanisms and provides knowledge for population management and invasion evaluation. Tetranychus ludeni Zacher (Acari: Tetranychidae) is an invasive species, which is native to Europe but now cosmopolitan. Here, we examined the effects of age and density on dispersal in mated females. Our results show that older females with more eggs were more likely to disperse and moved longer distances than younger ones with fewer eggs. Older females spread most of their eggs out of the natal habitats and over longer distances, which reduced competition and increased offspring fitness. Females significantly increased dispersal probability and distance with the increase of population density to avoid crowding. The synchronization of dispersal and reproduction, along with the positive density-dependent dispersal strategy, may facilitate habitat colonization and invasion speed of T. ludeni.

Temporal downscaling of gridded geophysical data is essential for improving climate models, weather forecasting, and environmental assessments. However, existing methods often could not accurately capture multi-scale temporal features, affecting their accuracy and reliability. To address this issue, we introduce an Enhanced Residual U-Net architecture for temporal downscaling. The architecture, which incorporates residual blocks, allows for deeper network structures without the risk of overfitting or vanishing gradients, thus capturing more complex temporal dependencies. The U-Net design inherently could capture multi-scale features, making it ideal for simulating various temporal dynamics. Moreover, we implement a flow regularization technique with advection loss to ensure that the model adheres to physical laws governing geophysical fields. Our experimental results across various variables within the ERA5 dataset demonstrate an improvement in downscaling accuracy, outperforming other methods.

Vehicle re-identification research under surveillance cameras has yielded impressive results. However, the challenge of Unmanned Aerial Vehicle (UAV)-based vehicle re-identification (ReID) presents a high degree of flexibility, mainly due to complicated shooting angles, occlusions, low discrimination of top-down features, and significant changes in vehicle scales. To address this, we propose a novel Dual Mixing Attention Network (DMANet) to extract discriminative features robust to variations in viewpoint. Specifically, we first present a plug-and-play Dual Mixing Attention Module (DMAM) to capture pixel-level pairwise relationships and channel dependencies, where DMAM is composed of Spatial Mixing Attention (SMA) and Channel Mixing Attention (CMA). First, the original feature is divided according to the dimensions of spatial and channel to obtain multiple subspaces. Then, a learnable weight is applied to capture the dependencies between local features in the mixture space. Finally, the features extracted from all subspaces are aggregated to promote their comprehensive feature interaction. Moreover, the DMAM can be readily inserted into backbone networks at any depth to improve vehicle discrimination. The experiments show that the proposed structure gains a better performance compared with the representative methods in the UAV-based vehicle ReID task. Our code and models will be publicly released.

Ethylene is an ideal CO2 product in an electrocatalytic CO2 reduction reaction (CO2RR), which has high economic value. In this paper, Al–doped octahedral Cu2O (Al–Cu2O) catalyst was synthesized by a simple wet chemical method. The selectivity of CO2RR products was improved by doping Al onto the surface of octahedral Cu2O by regulating the Al content. The Al–Cu2O was used as an efficient electrocatalyst for CO2RR with selective ethylene production. The Al–Cu2O exhibited a high Faradic efficiency (FEC2H4) of 44.9% at -1.23 V (vs. RHE) in CO2 saturated 0.1 M KHCO3 electrolyte. Charge transferring from Al atom to Cu atom take place after Al doping in Cu2O, thereby optimizing the electronic structure, which facilitates CO2RR to ethylene production. The DFT calculation showed that the Al–Cu2O catalyst can effectively reduce the adsorption energy of the *CHCOH intermediate and promote the mass transfer of charges, thus improving the FEC2H4. After Al doping into Cu2O, the center of d orbitals shift positively, which makes the d–band closer to the Fermi level. Furthermore, the density of electronic states increases, which was conducted to the interaction between Cu atoms and intermediates, thus accelerating the electrochemical CO2 reduction process. This work proved that the metal doping strategy can effectively improve the catalytic properties of Cu2O, thus providing a useful way for CO2 cycling and green production of C2H4.

By reviewing the research of development economics in recent years, five key terms of ‘innovation, coordination, green, openness and sharing’ are extracted, corresponding to the five dimensions of the New Development Concept advocated by China. Based on this, an evaluation index system of the development quality of China's fishery industry is constructed. The spatio-temporal characteristics of China's fishery industry development quality were analyzed by using the provincial panel data from 2007 to 2017. The results show that: i) China's fishery industry overall development quality continues to grow, while the variation of provincial quality is also increasing, and the contribution of innovation quality and sharing quality is increasing, becoming an important sub-dimension leading the overall development quality.ii) there is a significant spatial dependence among provincial quality, and the significance is further strengthening. The Hangzhou Bay area and Bohai Bay area have gradually become a dual-core area where the high-quality development of China's fishery industry agglomeration, and the radiation from the dual-core area to the peripheral areas may still be in the process of enhancement. The spatial and temporal distribution of China’s fishery industry development quality keeps the trend of ‘from northeast to southwest’, which is almost parallel to Hu Huanyong line. The gravity center of its distribution is close to the gravity center of Chinese population and economy, and the development quality experienced a process from relatively concentrated to dispersed and then returned to concentrated, and the development speed in the later period was higher than that in the earlier period. iii) Capital accumulation level is the dominant positive influencing factors, while government support level is the dominant negative influencing factors respectively, and both have significant spatial differentiation among provinces.

Automated extraction of buildings from earth observation (EO) data is important for various applications, including updating of maps, risk assessment, urban planning, policy making. Combining data from different sensors such as high-resolution multispectral (HRI) and light detection and ranging (LiDAR) has shown great potential in building extraction. Deep learning (DL) is increasingly used in multimodal data fusion and urban object extraction. However, DL-based multimodal fusion networks may underperform due to insufficient learning of “joint features” from multiple sources and oversimplified approaches to fusing multimodal features. Recently, an hybrid attention-aware fusion network (HAFNet) has been proposed for building extraction from a dataset including co-located Very-High-Resolution (VHR) optical images and Light Detection And Ranging (LiDAR) joint data. The system reported good performances thanks to the adaptivity of the attention mechanism to the features of the information content of the three streams but suffered from model overparametrization, which inevitably leads to long training times and heavy computational load. In this paper the authors propose a restructuring of the scheme, which involved replacing VGG-16-like encoders with the recently proposed EfficientNet, whose advantages counteract exactly the issues found with the HAFNet scheme. The novel configuration was tested on multiple benchmark datasets, reporting great improvements in terms of processing times, and also in terms of accuracy. The new scheme, called HAFNetE (HAFNet with EfficientNet integration), appears indeed capable of achieving good results with less parameters, translating into better computational efficiency. Based on these findings, we can conclude that, given the current advancements in single-thread schemes, the classical multi-thread HAFNet scheme could be effectively transformed by the HAFNetE scheme by replacing VGG-16 with EfficientNet blocks on each single thread. The remarkable reduction achieved in computational requirements moves the system one step closer to on-board implementation in a possible, future “urban mapping” satellite constellation.

Manual traffic surveillance can be a daunting task as Traffic Management Centers operate a myriad of cameras installed over a network. Injecting some level of automation could help lighten the workload of human operators performing manual surveillance and facilitate making proactive decisions which would reduce the impact of incidents and recurring congestion on roadways. This article presents a novel approach to automatically monitor real time traffic footage using deep convolutional neural networks and a stand-alone graphical user interface. The authors describe the results of research received in the process of developing models that serve as an integrated framework for an artificial intelligence enabled traffic monitoring system. The proposed system deploys several state-of-the-art deep learning algorithms to automate different traffic monitoring needs. Taking advantage of a large database of annotated video surveillance data, deep learning-based models are trained to detect queues, track stationary vehicles, and tabulate vehicle counts. A pixel-level segmentation approach is applied to detect traffic queues and predict severity. Real-time object detection algorithms coupled with different tracking systems are deployed to automatically detect stranded vehicles as well as perform vehicular counts. At each stages of development, interesting experimental results are presented to demonstrate the effectiveness of the proposed system. Overall, the results demonstrate that the proposed framework performs satisfactorily under varied conditions without being immensely impacted by environmental hazards such as blurry camera views, low illumination, rain, or snow.

Fracture density, a critical parameter of unconventional reservoirs, can be used to evaluate potential of unconventional reservoirs and location of production wells. Many technologies, such as amplitude variation with offset and azimuth (AVOA) technology, vertical seismic profiling (VSP) technology, and multicomponent seismic technology, are generally used to predict fracture of reservoirs. they can qualitatively predict fracture by analyzing seismic attributes, including seismic wave amplitudes, seismic wave velocities, which are sensitive to fracture. However, it is important to quantitatively describe fracture of reservoirs. In this study, based on a double-layer model, the relationships between fracture density and the double-layer model’s physical parameters, such as velocity of fast shear-wave, velocity of slow shear-wave, and density, were established, and then a powerful quantitative prediction method for fracture density was proposed dramatically. Afterwards, the Hudson model for crack was used to test the applicability of the method. The result shown that the quantitative prediction method for fracture density can be applied suitable to the Hudson model for crack. Finally, the result of validation models indicated that the method can predict fracture density effective, in which absolute relative deviation (ARD) were less than 5% and root-mean-square error (RMSE) was 4.88×10-3.

The genus Amomum encompasses six medicinal species that are extensively utilized and have a significant historical background. Due to their morphological similarities, however, the presence of counterfeit and substandard products remains a challenge. Accurate plant identification is therefore essential to address these issues. This study utilized 11 newly sequenced samples along with extensive data from NCBI to perform molecular identification of these six species. The plastomes of Amomum displayed a typical quadripartite structure with conserved gene content, yet showed independent variations in the SC/IR boundary shifts at both inter- and intra-specific levels. Our approach incorporated ITS, ITS1, ITS2, complete plastomes, matK, rbcL, and psbA-trnH sequences for molecular identification, which effectively differentiated the six medicinal species within the genus Amomum, as confirmed by distance-based and phylogenetic tree analyses. Among these, the ITS, ITS1, and complete plastomes sequences demonstrated the highest identification success rate (3/6), followed by ITS2, matK, and psbA-trnH (1/6). In contrast, rbcL failed to identify any species. This research successfully established a reliable molecular identification method for Amomum plants, to protect wild plant resources and promote the sustainable use of medicinal plants and restrict the exploitation of these resources.

In 2023, the technological landscape witnessed an unprecedented surge of transformative innovations, including Web 3.0 and machine learning, poised to revolutionize various aspects of our daily lives. At the forefront of this revolution stands artificial intelligence (AI), which has evolved from a concept once confined to science fiction into an indispensable force reshaping industries on a global scale. Notably, recent years have seen remarkable strides in AI functionalities, particularly in machine learning, computer vision, and natural language processing. These advancements have empowered AI to generate diverse interactions and media autonomously. This study ultimately provides invaluable insights into the dynamic intersection of AI and Advertising, con-tributing to a deeper comprehension of this evolving field. This study conducts a comprehensive review of Artificial Intelligence within the advertising domain, employing network analysis. By meticulously examining the evolution of AI through co-occurrences of terms, keywords, and co-authorship analysis, we aim to unveil the relationship of AI & Advertising through the lens of Generative models to identify pivotal trends, core concepts, and seminal studies that have profoundly influenced the industry. The analysis charts the trajectory leading to the emergence of Generative Artificial Intelligence (GenAI), a transformative development poised to revolutionize advertising practices and consumer engagement. In tandem with these objectives, the results highlight vital trends, emphasizing the growing prominence machine learning tools and techniques such as deep learning techniques and advanced natural language processing methods like word2vec, GANs, and more in shaping the future of advertising practices.

Barnyardgrass (Echinochloa spp.) is a prevalent type of weed in rice fields worldwide. Despite the growing knowledge concerning allelopathic interference with barnyardgrass, little is understood regarding the competitive mechanisms between allelopathic rice and herbicide-resistant barnyardgrass at the plant physiological level. In this context, a hydroponic system was employed to investigate the root morphological traits and different phytohormones levels of two rice cultivars, i.e., the allelopathic rice cultivar “PI312777” (PI) and the non-allelopathic rice cultivar “Lemont” (LE), when co-planted with quinclorac-resistant and -susceptible barnyardgrass, respectively. The results showed that the shoot and root biomass were greater in the allelopathic rice cultivar. Moreover, the treatments at the two time points induced an increase in shoot and root biomass of PI when subjected to barnyardgrass stress. In terms of root morphology, PI exhibited significantly higher fine-root length in diameters <0.5 mm, a greater number of root tips, and longer root tips compared to LE. In addition, the levels of different plant hormones, including auxin (IAA), abscisic acid (ABA), jasmonic acid (JA), and salicylic acid (SA), known for their diverse adaptation strategies to biotic stress, were analysed. The response to quinclorac-resistant barnyardgrass stress was consistent in terms of the content of well-known stress-related hormones, namely SA and JA. The accumulation of SA and JA was observed in both rice cultivars under the stress of quinclorac-resistant barnyardgrass, with higher contents of these hormones in PI than that in LE. The most significant change was observed in IAA and ABA contents in rice, which decreased significantly from 7 days to 14 days under co-culture stress. Additionally, PI contained higher levels of IAA and ABA than LE in the presence of barnyardgrass stress. This research may aid in the development of strategies for reducing the environmental impact of herbicides through the prudent selection of non-chemical herbicide control tactics.

Inconsistent results published in previous studies make it difficult to determine the precise effect of consumer knowledge on their acceptance of functional foods, which were developed to improve consumers’ health status by providing adequate nutrition. We conducted a systematic review and meta-analysis by identifying and collecting relevant literature from three databases. Of the 1050 studies we reviewed, we included 40 in the systematic review and 18 in meta-analysis. Based on the focus of each included study, we operationally defined knowledge as knowledge of the functional food concept, nutritional-related knowledge, and knowledge of specific functional products. Results from the systematic review indicate that most participants from the included studies had a low level of knowledge, especially nutrition-related knowledge associated with consuming functional foods, and they were generally not familiar with the concept of functional foods. It is possible that participants’ level of knowledge was influenced by their demographic characteristics (e.g., age, gender, educational level, marital status, nationality). Results from the meta-analysis generated a summary effect size (r = 0.14, 95% CI [0.05; 0.23]), measured by the correlation coefficient r, which indicates that a small positive relationship exists between consumers’ level of functional foods knowledge and their acceptance of functional foods.

Mechanical power and motion are often transmitted by the gear-rotor-bearing system. When there are fitting clearances between the housing and outer ring in bearings, complex vibration responses will be generated, which makes the operating status difficult to identify. Therefore, for analyzing dynamic responses, a dynamic model of gear-rotor-bearing systems with bearing fitting clearances is proposed. In the model, the bearing system with fitting clearances and gear pair system are combined, and the coupling relationship is determined by the gyroscopic mo-tion of the shaft. The friction force and collision force caused by fitting clearances are also con-sidered, which are simulated by the Coulomb friction model and Hertz theory. The result shows that the meshing stiffness will also be excited by the bearing displacement. When there are fit-ting clearances on the bearing, the amplitude modulation of the bearing outer raceway to the system time-domain response is intensified, and the multiple harmonic frequency of bearings and gear pairs are generated on the spectrum, as well as defect frequencies of gear pairs. As the fitting clearance is increased, the higher multiple harmonic responses will be caused. Although the response amplitude of the gearbox is increased by raising the input speed, multiple harmon-ic responses are suppressed, which makes the system mainly vibrate at the fundamental fre-quency. Then, the dynamic model and the vibration analysis are experimentally verified.

MCrAlX (M: Ni or Co or both, X: minor elements) coatings have been widely used to protect hot components in gas turbines against oxidation and hot corrosion at high temperatures. Understanding the influence of the X-elements on oxidation behaviour is important in the design of durable MCrAlX coatings. In this study, NiCoCrAlX coatings doped with Y+Ru and Ce, respectively, were deposited on Inconel-792 substrate by HVOF. The samples were subjected to isothermal oxidation test in laboratory air at 9000, 1000, 1100 ºC and cyclic oxidation test between 100 ºC and 1100 ºC with 1 hour dwell time at 1100 ºC. It was observed that the coating with Ce shows a much higher oxidation rate than the coating with Y+Ru under both isothermal and cyclic oxidation tests. Besides, β-depletion due to interdiffusion between coating and substrate was significantly lower with Ru addition. Simulations results using both a moving phase boundary model and an established oxidation-diffusion model show that Ru stabilize β grains which reduces β-depletion of coating due to substrate interdiffusion. This paper presents a comprehensive study of the influence of Ce and Ru on oxidation behaviour including investigation of the microstructure evolution influenced by oxidation time at coating surface and coating-substrate interface combining experiment and simulation results.

Vaccination represents the historical milestone in medical sciences, which has been saving millions of lives. Nonetheless, continued outbreaks of emergent infectious diseases are swamping from every coast to every border all over the world. Modern vaccines are our most powerful arsenals to defend the public health of a global population ever since 1796. As unexpected, modern vaccination approaches have brought out all sorts of unwelcome pathogenic disorders to varying extents. Pathogenic viruses have also continued to evolve to defeat elaborate arsenals devised by human intelligence. In this review, we have covered a variety of vaccination approaches along with their sophisticated materials from the past to the most recent development. Furthermore, we discuss varied serious pathogenic outcomes elicited by contemporary vaccination programmes involving novel materials in real clinical trials. The complex immune mediators will be discussed in the context to tackle the complication of vaccine-induced pathogenesis. We will offer the insight into the intractable discrepancy of vaccine-associated pathology. The precision approach bestowed with evolutionary concepts will be considered as a feasible option to confront various issues of pathogenic complicacy.

Hepatocellular carcinoma (HCC) is characterized by uncontrolled cellular proliferation driven by aberrant signal transduction. Cells respond to potential carcinogenic signals by inducing cellular senescence (CS) as a defense mechanism. However, assessing CS levels in various tumors is challenging due to heterogeneity and the lack of universal CS markers. This study integrates single-cell RNA sequencing (scRNA-seq) and bulk RNA-seq data from HCC samples to analyze gene expression profiles. HCC-specific senescence-related pathways are identified, and genes from these pathways distinguish molecular subtypes associated with senescence in HCC. These subtypes exhibit significant variations in biological and clinical attributes. A specific CS risk model is developed, revealing associations between CS scores and prognosis, clinical staging, immune infiltration, immunotherapy response, and drug sensitivity. The key gene G6PD is identified as a potential senescence-related target in liver cancer. Molecular experiments confirm the effective suppression of HepG2 cell proliferation, invasion, and migration upon G6PD knockdown. In summary, this analysis enhances our understanding of HCC-specific senescence molecular features and introduces a novel senescence-related biomarker, offering promising implications for future research.

In order to improve the stiffness of the flexible robot,this paper proposes a variable-stiffness elastic actuator to improve the rigidity of flexible robots. The actuator integrates the working principles of a pneumatic drive, wedge structure, and particle blockage. the tensile stiffness of the actuator is nonlinearly negatively correlated with the air pressure because of the structural and material properties.The compressive stiffness and lateral stiffness increases nonlinearly as air pressure increases, being 3and 121 times greater at 0.17 MPa compared to 0 MPa, respectively. Beyond 0.17 MPa, the two stiffness of the actuator experiences incremental growth due to wedge impedance forces.

The effects of exogenous inorganic [i.e., nitrate (NO3-)/ammonium (NH4+)] and organic [i.e., glutamate (Glu)/argine (Arg)] N alone and in combination on the accumulation of proline (Pro) in rice plant under trivalent chromium [Cr(III)] stress were studied through the mass balance matrix model (MBMM). ‘NH4+’ application showed the largest contribution to the Pro content in rice shoots under different concentrations of Cr(III), followed by ‘NO3-’, ‘Arg’, and ‘Glu’ application respectively. While, ‘Arg’ application displayed the largest contribution to the Pro content in roots under Cr(III) stress, followed by ‘NH4+’, ‘Glu’, and ‘NO3-’ application. Among the combination cases of N sources used, the application of ‘NH4++Arg’ showed the greatest contribution to the Pro content in both roots and shoots of Cr(III)-treated rice seedlings, while the application of ‘NO3-+Glu’ showed the least contribution to the Pro content in rice seedlings under Cr(III) stress. Results from this study indicated that the level of indigenous Pro in rice seedlings is quite sensitive to Cr(III) stress under different N sources, and mathematical modeling showed a reliable result to estimate the relationship between Pro content and N source application in rice plants in response to Cr(III) exposure .

In this work, we try to find a way to describe the physical law of micro-world under the frame of a space-time theory. By introducing the scalar fields $\mathcal{D}\left( x\right)$ and $\zeta\left( x\right) $, we rewrite the action of conventional field theory and the Lagrangian describing the motion of the particle, where a modified space-time relation is obtained. To test the correctness of this attempt, we demonstrate the Klein-Gordon equation by the Hamilton-Jacobi method in four dimensional form and present a time delay for the ground state of hydrogen atom.

The aim of the present study was to assess the efficacy of All Cosmos Industries (ACI) bio-organic and bio-chemical fertilizers and ACI N-Fixer (N-Bio Booster) on the paddy yields based on the field trial plots at Langkat, Medan, Indonesia. This application of ACI bio-organic fertilizer (NPK 5/5/5) and ACI bio-chemical (NPK 15/15/15) fertilizer and ACI N-Fixer tests were conducted at the paddy farm at Langkat from May-October 2018. This study employed a factorial randomized complete block design which consisted of two factors, namely: Factor I with four types of fertilizers while Factor II consisted of two paddy varieties (Inpari 30 and Inpari 32). Overall, the filled grains in the ACI treatments are significantly (P< 0.05) higher than those in the control treatments that used Normal Chemical Compound NPK. Overall, total weight per meter² (368-617g) in ACI treatments are also significantly (P< 0.05) higher than those (319-371g) in the control treatments. At harvesting time at 105 days after transplanting, significantly higher (P< 0.05) colony counts (13-15 x 10⁶ CFU/mL) (for ACI treatments), than those (8 x 10⁶ CFU/mL) in the controls positively indicated higher total yields of paddy grains per hectare. It was found that the application of ACI bio-organic and bio-chemical fertilizers and ACI N-Fixer can improve paddy yields of the two rice varieties, between 16.4-38.2% (up to 5.75 MT/ha), in the field trial plots at Langkat. These commercial fertilizers play an imperative role in refining the soil fertility and thereby can increase the yield of rice production. Therefore, it is highly recommended that ACI bio-organic and ACI bio-chemical fertilizers and ACI N-Fixer (N-Bio Booster) can be employed to increase the paddy yield in this region.

This paper focused on the oxidative leaching process of vanadium from vanadium-chromium reducing residue in alkaline medium with MnO₂. The effect of experimental parameters including reaction time, reaction temperature, dosage of MnO₂, dosage of NaOH, and liquid-to-solid ratio on the leaching efficiency of vanadium had been studied. The results indicated that MnO₂ was an efficient oxidant for leaching out of vanadium. The leaching efficiency of vanadium was up to 97.25% under optimal reaction conditions: reaction temperature of 90 ℃, reaction time of 60 min, dosage of MnO₂ at 50 wt.%, concentration of NaOH at 30 wt.% and liquid-to-solid at 5:1 mL/g.

We report herein high-resolution x-ray diffraction measurements of basal plane bending of homoepitaxial single-crystal diamond (SCD). The results reveal that growth parameters such as temperature, growth time and basal plane bending of the substrate affect the basal plane bending of SCD. First, the basal plane bending of SCD depends mainly on the substrate itself. The basal plane bending of SCD becomes more severe with increasing basal plane bending of the substrate and this type of basal plane bending cannot be recovered. The SCD growth experiments show that the basal plane bending increases at high temperature and with increasing growth time. Finally, to understand the mechanism behind basal plane bending, we investigate the substrate-surface temperature distribution as a function of basal plane bending of SCD fabricated by chemical vapour deposition (CVD). This allows us to propose a bending model and understand the origin of basal plane bending. The results indicate that an uneven temperature distribution on the substrate surface is the main cause of the CVD diamond base-plane bending.

Lung cancer (LC) stands as the foremost cause of cancer-related fatality rates worldwide. Early diagnosis significantly enhances patient survival rate. Nowadays, low dose computed tomography (LDCT) is widely employed on chest as a tool for large-scale lung cancer screening. Nonetheless, a large amount of chest radiographs causes an onerous burden on radiologists. Some computer-aided diagnostic (CAD) tools can provide insights to medical images for diagnosis and augmenting diagnostic speed. However, due to variation in parameter settings across different patients, substantial discrepancies in image voxels persist. We find different voxel-size causing a compromise between model generalization and diagnostic efficacy. This study investigates the performance disparities of diagnostic models trained on original images and LDCT images reconstructed to different voxel-sizes but isotropic. The application is to differentiate a nodule to be benign or malignant. Using 11 features, a support vector machine (SVM) is trained on LDCT images with an isotropic voxel having side-length of 1.5 mm for 225 patients in house. The result yields a favorable model performance with an accuracy of 0.9596 and an area under the receiver operating characteristic curve (ROC/AUC) of 0.9855. In addition to furnish CAD tools for clinical applications, future research is encouraged to include LDCT images from multi-centers.

In order to solve the problem of many constraints and complex navigation environment in the path planning of unmanned surface vehicle(USV), an improved Sparrow search algorithm com-bining Cubic chaotic map and Gaussian random walk strategy was proposed to plan it. Firstly, in the population initialization stage, Cubic chaotic map was used to replace the random generation method of the traditional sparrow search algorithm to optimize the uneven initial distribution of the population and improve the global search ability of the population. Secondly, in the late it-eration of the algorithm, the standard deviation of fitness is introduced to determine whether the population is trapped in the local optimum. If true, the Gaussian random walk strategy is used to perturb the optimal individual and assist the algorithm to escape the local optimum. Thirdly, the chosen water environment is modeled, and the navigation information of the original inland electronic navigation chart(ENC) is preprocessed, gridized, and the obstacle swelling is processed. Finally, the path planning experiments of USV are carried out in inland ENC grid environment. The experimental results show that, compared with the traditional sparrow search algorithm, the average fitness value of the path planned by improved sparrow search algorithm is reduced by 14.8%, and the variance is reduced by 49.9%. The path planned by the algorithm is of good quality and high stability, and combined with ENC, it can provide a reliable path for USV.

The layer-by-layer (LBL) fabrication method allows for controlled microstructure morphology and vertical component distribution, and also offers a reproducible and efficient technique for fabricating large-scale organic solar cells (OSCs). In this study, polymer D18 and PYIT-OD are employed to fabricate all-polymer solar cells (all-PSCs) using the LBL method. Morphological studies reveal that the use of additives optimizes the microstructure of the active layer, enhancing the crystallinity and charge transport capability. The optimized device with 2% CN additive significantly reduces bimolecular recombination and trap-assisted recombination. All-PSCs fabricated by the LBL method based on D18/PYIT-OD deliver a power conversion efficiency (PCE) of 15.07%. Our study demonstrates the great potential of additive engineering via LBL fabrication method in regulating microstructure of active layers, suppressing charge recombination, and enhancing the photovoltaic performance of devices.

Infrared small target detection (ISTD) plays a crucial role in both civilian and military applications. The detection of small targets against dense cluttered backgrounds remains a challenging task, requiring the collaboration of false alarm source elimination and target detection. Existing approaches primarily focus on modeling targets while often neglecting false alarm sources. To address this limitation, we propose a Target and False Alarm Collaborative Detection Network to leverage the information provided by false alarm sources and the background. Firstly, we introduce a False Alarm Source Estimation Block (FEB) that estimates potential interferences present in the background by extracting features on multiple scales and employing stepwise upsampling for feature fusion. Subsequently, we propose a framework that employs multiple FEBs to eliminate false alarm sources across multiple scales. Finally, a Target Segmentation Block (TSB) is introduced to accurately segment the targets to produce the final detection result. Experiments on public datasets demonstrate that, compared to other methods, our model achieves high accuracy in segmenting targets while being able to extract false alarm sources which can be used for further studies.

In this paper, a swarm trajectory planning method is proposed for multiple autonomous surface vehicles (ASVs) in an unknown and obstacle-rich environment. Specifically, based on the point cloud information of the surrounding environment obtained from local sensors, a kinodynamic path searching method is used to generate a series of waypoints in the discretized control space at first. Next, after fitting B-spline curves to the obtained waypoints, a nonlinear optimization problem is formulated to optimize the B-spline curves based on gradient-based local planning. Finally, a numerical optimization method is used to solve the optimization problems in real-time to obtain collision-free, smooth and dynamically feasible trajectories relying on a shared network. Simulation results demonstrate the effectiveness and efficiency of the proposed swarm trajectory planning method for a network of ASVs.

As the most important city in China, Beijing has experienced an economic soar, large-scale population growth and eco-environment changes in recent 20 years.Evaluating climate and human-induced vegetation changes could reveal the relationship of vegetation-climate-human activities and provide important insights for the coordination of economic growth and environmental protection. Based on a long-term MODIS vegetation index dataset, meteorological data (temperature, precipitation) and impervious surface data, the Theil-Sen regression and the Mann-Kendall method are used to estimate vegetation change trend in this study and the residual analysis is utilized to distinguish the impacts of climate factors and human activities on vegetation restoration and degradation from 2000 to 2019 in Beijing. Our results show that the increasing vegetation areas account for 80.2\% of Beijing. The restoration of vegetation is concentrated in the urban core area and mountainous area, while the degradation of vegetation is mainly concentrated in the suburbs. In recent years, the vegetation in most mountainous areas has changed from restoration to significant restoration, indicating that the growth of mountain vegetation has continued to restore. We also found that in the process of urban expansion, vegetation browning occurred in 53.1\% of the urban built-up area, while vegetation greening occurred in the rest part. We concluded that precipitation is the main climatic factor affecting the growth of vegetation in Beijing mountain areas through correlation analysis. Human activities have significantly promoted the vegetation growing in the northern mountainous area thanks to the establishment of environmental protection areas. The negative correlation between vegetation and the impervious surface tends to gradually expand outwards, which is consistent with the trend of urban expansion. The positive correlation region remains stable, but the positive correlation is gradually enhanced. The response of vegetation to urbanization demonstrated a high degree of spatial heterogeneity. These findings indicated that human activities played an increasingly important role in influencing vegetation changes in Beijing.

Curriculum teaching is the basic unit to realize the cultivation and achievement of students’ ability in undergraduate colleges, and it is very important to investigate the influence mechanism of the curriculum system on the achievement states of students' ability. This paper first puts forward the theoretical system and framework of curriculum chains, and constructs a “double-energy and double-space” (DEDS) which consist of the curriculum energy efficiency space and student ability space respectively. Investigating the space-time transformation relationship of curriculum chains in the DEDS, the forward transformation model, inverse transformation model and the rheological model of the achievement states in the curriculum energy efficiency space and student ability space are established. Studying the dynamic evolution mechanism of curriculum chains within the DEDS, the dynamic evolution model, which presents the relationship between achievement states of curriculum energy efficiency/students' ability and curriculum/students' dynamic potential, are established; the control methods of courses/students' dynamic potential based on the proposed dynamic evolution model are developed to ensure the achievements of the graduates’ social ability; the evaluation and detection methods of achievement states of curriculum chains in DEDS are proposed to obtain the actual achievement states of curriculum energy efficiency and students’ ability, and this will provide effective input for the control of curriculums/students’ dynamic potential; the planning and design methods of curriculum chains facing social needs are presented, which can provide theoretical basis for the formulation of the talent training scheme and curriculum system in colleges and universities.

Micro-nanoparticles' characteristics in geothermal fluids can be applied to detect of deep hidden geothermal resources. Observations using a nanoparticle tracking analyzer (NTA) indicated that the karst geothermal water collected in the central area of Shandong Province (Jinan and Zibo) contains many natural micro-nanoparticles with sizes primarily ranging between 100 nm and 5 μm. The micro-nanoparticles’ type, shape, crystal form, and chemical composition in the samples were analyzed using transmission electron microscopy (TEM). TEM images and energy dispersive spectroscopy showed that the micro-nanoparticles in geothermal water samples were mostly amorphous, irregular, or nearly spherical, with rough edges. The micro-nanoparticles were mainly carbonates, sulfates, and chlorine-containing Fe, Ca, Na, and Mg. The characteristics of the particles can reveal the properties of the deep, hot reservoirs and aquifers from where they originate. Therefore, we believe that natural micro-nanoparticles can be essential to detecting and studying deep, hidden geothermal resources, which is a novel approach to exploring deep, hidden geothermal resources.

Recent advances in embedded antenna and sensor technologies for 5G communications have galvanized a response toward the investigation of their electromagnetic (EM) performance for urban context and civil engineering applications. This article quantitatively investigates the effects of material loading on an evolved antecedent-based design of a hexagonal-stubbed Complementary Split-Ring Resonator (CSRR)-loaded antenna through simulation and experimentation. The optimized antenna design is first conceptualized within a simulation environment to achieve EM resonance at 3.50 GHz before delving into the analysis of operational performance characteristics. As a proof-of-concept, a physical antenna prototype is fabricated on a printed circuit board for the in-situ evaluation of S11 parameter plot. Subsequently, a simulation-based parametric study is conducted on antenna prototypes embedded into Ordinary Portland Cement pastes with varying weight percentages of iron(III) oxide. Simulation-derived and experimental results are mutually verified, achieving a systemic downward shift in resonant frequency and corresponding variations in impedance matching induced by changes in the loading reactance. Finally, an inversion modeling procedure is employed using perturbation theory to extrapolate the relative permittivity of the dielectric embedding materials. Our proposed analysis contributes to optimizing concrete-embedded 5G antenna sensor designs and establishes a foundational framework for estimating unknown EM parameters of cement-based composites.

As a new distributed machine learning (ML) approach, federated learning (FL) shows the great potential to preserve data privacy by enabling distributed data owners to collaboratively build a global model without sharing their raw data. However, the heterogeneity in terms of data distribution and hardware configurations make it hard to select participants from the thousands of nodes. In this paper, we propose a multi-objective node selection approach to improve time-to-accuracy performance while resisting malicious nodes. We firstly design a deep reinforcement learning assisted FL framework. Then the problem of multi-objective node selection under this framework is formulated as a Markov decision process (MDP), which aims to reduce the training time and improve model accuracy simultaneously. Finally, a deep Q-netwok (DQN) based algorithm is proposed to efficiently solve the optimal set of participants for each iteration. Simulation results show that the proposed method not only significantly improves the accuracy and training speed of FL, but has stronger robustness to resist malicious nodes.

Image fusion is the process of combining multiple input images from single or multiple imaging modalities into a fused image, which is expected to be more informative for human or machine perception as compared to any of the input images. In this paper, we propose a novel method based on deep learning for fusing infrared images and visible images, named the LBP-based proportional input generative adversarial network (LPGAN). In the image fusion task, the preservation of structural similarity and image gradient information is contradictory, and it is difficult for both to achieve good performance at the same time. To solve this problem, we innovatively introduce Local Binary Patterns (LBP) into Generative Adversarial Networks (GANs), which effectively utilize the texture features of the source images, so that the network has stronger feature extraction ability and anti-interference ability. In the feature extraction stage, we introduce a pseudo-siamese network for the generator to extract the detailed features and the contrast features. At the same time, considering the characteristic distribution of different modal images, we propose a 1:4 scale input mode. Extensive experiments on the publicly available TNO dataset and CVC14 dataset show that the proposed method achieves the state-of-the-art performance. We also test the universality of LPGAN through the fusion of RGB and infrared images on the RoadScene dataset. In addition, LPGAN is applied to multi-spectral remote sensing image fusion. Both qualitative and quantitative experiments demonstrate that our LPGAN can not only achieve good structural similarity, but also retain rich detailed information.

Here, a process for leaching vanadium from calcified roasting pellets (CPVC) of vanadium-titanium iron concentrate by a two-stage sulfuric acid cycle was proposed. When the silicon removal acid concentration of the pellet in the first stage was 1.5 mol/L, the solid-liquid ratio was 6: 1, the silicon removal acid concentration of the leaching solution was 3.0 mol/L, and the standing time was 48 h, the silica gel formation time was 23 h, the filtration time was 70 s, and the loss rates of vanadium and iron were 1.52% and 0.17%, respectively. When the acid concentration was 2 mol/L, at room temperature, using a leaching time of 28 days, and a solid-liquid ratio of 5: 1 in the second stage, the total leaching rates of vanadium and iron were 75.52% and 0.71%, respectively. The concentration of vanadium in the leaching solution reached 6.80 g/L, and vanadium was directly precipitated without extraction. After secondary roasting, the crushing strength of the pellets reached 2250 N, which met the requirement for blast furnace iron making. The Eh-pH diagrams of the V-Fe-H2O system at different temperatures were plotted. Thermodynamically, it was difficult to selectively leach vanadium and iron by changing the conventional acid leaching conditions. In addition, the pellets before and after leaching were analyzed. The grade of iron in the pellets increased slightly after leaching, and the main phases in the pellets remained as Fe2O3 and Fe9TiO15. The S in the sulfuric acid solution entered the leached pellets during the acid leaching reaction and was removed by the secondary roasting of the leached pellets.

Ultrasound based haptic feedback is a potential technology for human-computer interaction (HCI) with the advantages of low cost, low power consumption and controlled force. In this paper, the phase optimization for multipoint haptic feedback based on ultrasound array is investigated and the corresponding experimental verification is provided. A mathematical model of acoustic pressure is established for the ultrasound array and then a phase optimization model for an ultrasound transducer is constructed. We propose a pseudo-inverse (PINV) algorithm to accurately determine the phase contribution of each transducer in the ultrasound array. By controlling the phase difference of the ultrasound array, the multipoint focusing forces are formed leading to various shapes such as geometries and letters that can be visualized. Because the unconstrained PINV solution results in unequal amplitudes for each transducer, a weighted amplitude iterative optimization is deployed to further optimize the phase solution, by which the uniform amplitude distributions of each transducer are obtained. For the purpose of experimental verifications, a platform of ultrasound haptic feedback consisting of a Field Programmable Gate Array (FPGA), an electrical circuit and an ultrasound transducer array is prototyped. The haptic performances of single point, multiple points and dynamic trajectory were verified by controlling the ultrasound force exerted on the liquid surface. The experimental results demonstrate that the proposed phase optimization model and theoretical results are effective and feasible, and the acoustic pressure distribution is consistent with the simulation results.

(1) Background: Investigating the characteristics of photosynthetic physiological changes of leaves in Mangifera indica L. cv. 'GuIfei' under enhanced UV-B radiation, natural light exposed trees were regarded as control, and 96 kJ·m-2·d-1enhanced UV-B radiation was artificially simulated in the field; (2) Methods: The changes of fruit maturity and fruit quality, leaf net photosynthetic rate (Pn), photosynthetic pigments contents, photochemical reaction, activities of photosynthetic enzymes and their genes expressions were determined; (3) Results: Compared with CK, the percentage of mature fruits of the treatment was significantly increased, and fruit quality was better. The net photosynthetic rate (Pn), the contents of photosynthetic pigment, Hill reaction activity and photochemical quenching coefficient (qP) of the treatment leaves showed a significantly higher trend than CK. The activities of Rubisco and RCA, and the expression of Rubisco genes rbcL and rbcS were significantly increased; (4) Conclusions: 96 kJ·m-2·d-1 enhanced UV-B radiation treatment improved Rubisco activity through increasing the expression of Rubisco genes rbcL and rbcS, thereby enhancing the CO2-fixing capacity and dark reaction capacity of leaves. Based on this, it raised the net photosynthetic rate of leaves, which promoted the early maturity of 'Guifei' mango by the fast accumulating photosynthetic products.

Cardiovascular disease (CVD) is one of the contributing factors to more than one-third of human mortality and the leading cause of death worldwide. Cardiac myocyte death is a fundamental process in cardiac pathologies caused by various heart diseases, including myocardial infarction. Thus, strategies for replacing fibrotic tissue in the infarcted region with functional myocardium have long been a goal of cardiovascular research. This review focuses primarily on induced-pluripotent stem cells (iPSCs), which have emerged as perhaps the most promising source of cardiomyocytes for both therapeutic applications and drug testing. We also briefly summarize other stems- and progenitor-cell populations that have been used for regenerative myocardial therapy and attempt to generate cardiomyocytes directly from cardiac fibroblasts (i.e., transdifferentiation), which, if successful, may enable the pool of endogenous cardiac fibroblasts to be used as an in-situ source of cardiomyocytes for myocardial repair.

Objective: Application of ERA methods to investigate the atmospheric pollution and built environment factors influencing lung cancer incidence rate in Chinese women. Methods: Lung cancer incidence rate among Chinese women at 339 cancer registries were obtained from the China Cancer Registry Annual Report 2017, air quality and built environment data were obtained from the Greenpeace and China Construction Yearbook. After multiple covariates variables were eliminated, an exploratory regression analysis was performed using the world standardized population incidence rate as the dependent variable. Air quality and built environment factors as the independent variable. Results: Shandong Peninsula, Hebei and Liaoning are high incidence rate areas of female lung cancer in China, with significant regional aggregation. In addition to air quality factors such as industrial smoke emission data, the association between built environmental factors such as urbanization rate, development LUI, population density and greening coverage of built-up areas and female lung cancer incidence rate is statistically significant. Conclusion: In addition to air quality factors, urban spatial factors can also significantly affect respiratory health. The LUI is positively while urbanization rates and population density are negatively correlated with the incidence rate of lung cancer. The role of green space for respiratory health has not been proven. In addition, there is little relationship between income and health, and similar findings are found for indicators such as the public transportation and roads network.

Corona viruses hijack human enzymes to assembly sugar coat on Spike glycoproteins. The mechanism that human antibodies may uncover the antigenic viral peptide epitopes hidden by sugar coat are unknown. In this study, we analyzed recombinant SARS-CoV-2 Spike protein secreted from BTI-Tn-5B1-4 cells, by trypsin and chymotrypsin digestion followed by mass spectrometry analysis. We acquired MS/MS spectrums for glycopeptides of all 22 predicted N-glycosylated sites. We further analyzed the surface accessibility of Spike proteins according to Cryo-EM and homolog-modeled structures, and available antibodies that bind to SARS-CoV-1. The results showed that all 22 N-glycosylated sites of SARS-CoV-2 are modified by high-mannose type of N-glycans. MS/MS fragmentation clearly established the glycopeptide identities. Electron densities of glycans cover most of the Spike receptor binding domain of SARS-CoV-2, except YQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQ, similar to a region FSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQ in SARS-CoV-1. Other surface-exposed domains included those located on Central Helix, between amino acids 967 and 1016 of SARS-CoV-1, and 985 to 1034 of SARS-CoV-2 Spike protein. As the majority of antibody paratopes bind to peptide portion with or without sugar modification, we propose a snake-catcher model that a minimal length of peptide is first clamped by a paratope, and the binding is either strengthened by sugars close to peptide, or not interfered by sugar modification.

In response to the COVID-19 pandemic, the Philippines placed the majority of the country under enhanced community quarantine, restricting the movement of most of its 100 million plus population. These aggressive measures were initiated on March 15, 2020 and intensified on March 17. According to official data, the number of confirmed COVID-19 cases has exponentially increased during this period, but it is important to note that the number of patients tested also substantially increased during the same period. It is not conclusive that widespread transmission of COVID-19 only started in March and our analysis suggests that community transmission was happening earlier. In discussing extended quarantine measures, it is important to properly understand the trends and recognize the limitations of the data. The unintended consequences on the population, especially in lower-middle income countries with fragile health systems like the Philippines, must be carefully considered.

The latest emergence of a novel coronavirus (COVID-19) had caused an outbreak of respiratory virus infections in Wuhan, China, and other countries so that the world health organization (WHO) declared the COVID-19 epidemic as a Public Health Emergency of International Concern (PHEIC) on January 31, 2020. At present, it is the fact that we have identified the bats as the host, the route of respiratory droplets, contact, and aerosol can accelerate the transmission from person to person. However, it is not well known about the intermediator and other approaches. Identifying and characterizing the origin and host(s) of COVID-19 can help us to evaluate the potential risk of COVID-19 for transmission among humans or cross-species.

Directional modulation (DM), as an emerging promising physical layer security (PLS) technique at the transmitter side with the help of an antenna array, has developed rapidly over decades. In this study, a DM technique using a polarization sensitive array (PSA) to produce the modulation with different polarization states (PSs) at different directions is investigated. A PSA, as a vector sensor, can be employed for more effective DM for an additional degree of freedom (DOF) provided in the polarization domain. The polarization information can be exploited to transmit different data streams simultaneously at the same directions, same frequency, but with different PSs in the desired directions to increase the channel capacity, and with random PSs off the desired directions to enhance PLS. The proposed method has the capability of concurrently projecting independent signals into different specified spatial directions while simultaneously distorting signal constellation in all other directions. The symbol error rate (SER), secrecy rate, and the robustness of the proposed DM scheme are analyzed. Design examples for single- and multi-beam DM systems are also presented. Simulations corroborate that 1) the proposed method is more effective for PLS; 2) the proposed DM scheme is more power-efficient than the traditional artificial noise aided DM schemes; and 3) the channel capacity is significantly improved compared with conventional scalar antenna arrays.

NiFe alloy nanoparticles/graphene oxide hybrid (NiFe/GO) was prepared for electrochemical glucose sensing. The as-prepared NiFe/GO hybrid was characterized by transmission electron microscopy (TEM) and X-ray diffraction (XRD). The results indicated that NiFe alloy nanoparticles can be successfully deposited on GO. The electrochemical glucose sensing performance of the as-prepared NiFe/GO was studied by cyclic voltammetry and amperometric measurement. Results showed that NiFe/GO modified glassy carbon electrode had sensitivity of 173 μA mM⁻¹cm⁻² for glucose sensing with a linear range up to 5 mM, which was superior to commonly used Ni nanoparticles. Furthermore, high selectivity for glucose detection can be achieved by NiFe/GO. All the results demonstrated that NiFe/GO hybrid was promising for using in electrochemical glucose sensing.

There are some limitations in the null test measurement in the stitching interferometry. In order to meet the null test conditions, the moving distance between the sub-apertures often deviates from the theoretical preset distance, which leads to a position deviation of sub-apertures under measurements. To overcome this problem, an algorithm for data processing is proposed. We used iterative calculation of the deviations between the sub-apertures to adjust their positions, to ensure the local validity of the linear approximation algorithm and realize the exact stitching. A cylindrical lens as an object for experimental examination of the proposed method was taken. The obtained results demonstrate the validity, reliability and feasibility of our iterative stitching algorithm.

Full-scale/model test comparison studies to validate the traditional ABL wind tunnel simulation technique are reviewed. According to the literature review, notable discrepancies between full-scale measurement results and model test results were observed by most performed comparison studies, but the causes of the observed discrepancies were not revealed in a scientific way by those studies. In this regard, a new research scheme for future full-scale/model test comparison studies is proposed in this article, which utilizes the multiple-fan actively controlled wind tunnel simulation technique. With the new research scheme, future full-scale/model test comparison studies are expected to reasonably disclose the main problems with the traditional ABL wind tunnel simulation technique, and the technique can be improved correspondingly.

With an increase in energy consumption globally, Fischer-Tropsch (FT) synthesis is a good alternative for producing fuels and chemicals from coal, natural gas or biomass. Among them, coal to liquids has been put into production in countries that have large coal reserves. In this process, Fe-based catalysts are commonly used due to their earth abundance, comparatively wide operation range and ready availability to handle low H2/CO ratio from coal. Despite their extensive applications, the kinetic and mechanistic understandings of Fe carburization and FT reaction on Fe-carbides are relatively limited due to the complexity of phase composition of the applied catalysts. This review summarizes the current state of knowledge of FT synthesis on Fe-carbide with an emphasis on underlying mechanism. Specifically, the employment of model catalyst, such as Raney-Fe, could provide a convenient way to furnish kinetic information regarding Fe carburization and subsequent FT reaction. A major challenge for further understanding catalytic reactions occurring at the Fe-carbide surface is correlating FT activity and selectivity to specific active site. To address this issue, the advancements of both DFT calculations and surface science techniques are highly demanded.

This study aims to quantify greenhouse gas (GHG) emissions from China's sludge treatment industry and explore the potential of novel technologies to mitigate these emissions, promoting sustainable sludge management practices. Using a life cycle assessment approach, the total GHG emissions from sludge treatment in 2017 were estimated at 18.54 Mt CO2-eq, with significant regional variations. Incineration contributed the highest emissions (1,011.53 kg CO2-eq/t dry sludge), followed by landfill (717.51 kg CO2-eq/t) and land application (276.41 kg CO2-eq/t). The uneven distribution of emissions across cities highlights the need for targeted mitigation strategies that consider local sustainability challenges. Principal component analysis revealed that economic factors and treatment scale significantly influence emissions, emphasizing the importance of integrating sustainability goals with economic development. To reduce the carbon footprint of sludge treatment and enhance sustainability, the mitigation potential and costs of various technologies were evaluated, including thermal conversion, anaerobic digestion, hydrothermal processes, and wet oxidation. These technologies offer GHG emission reductions ranging from 0.09 to 0.46 t CO2-eq/t dry solids compared to conventional methods, while also promoting resource recovery and circular economy principles. However, further optimization is necessary to enhance their environmental and economic performance, ensuring long-term sustainability. By implementing these technologies and adopting optimization strategies, China's sludge treatment industry can significantly contribute to achieving the country's carbon neutrality goal and fostering sustainable development.

Abstract—Hydraulic switching actuators are high efficiency, fast response, and low cost solutions for hydraulic control systems. One of the challenging problems is throttling losses during valve transitions. Previously the authors proposed a zero-flowrate switching method to reduce throttling energy loss of the switching valve, where a hydraulic resonator is applied to make the flowrates through the lines approaching zero before the valves are switched off. The major challenge of this approach is fast switching valves whose transition times are less than 2 ms. In this paper, an improved zero-flowrate switching method is presented. It utilizes the capacity with independent inlet/outlet ports to regulate flowrates through the lines. Models of capacity applied in a simple line with different pressure signals are developed to explore characteristics of the capacity, based on which a complete actuation system is developed. In the complete model, resistance and inductance are optimized to achieve desired flowrate response. The improved zero-flowrate switching method reduces throttling energy losses by 99.945% compared to a hard switching system. The simulation results demonstrated that the improved zero-flowrate switching method performs as expected in the design condition. A capacity with proper volume is able to regulate flowrates through all the lines to zero, with the help of appropriate resistance and inductance. Compared to previous zero-flowrate switching method, the novel strategy allows slower switching valves applied in hydraulic actuation systems and achieves better efficiency performance. This research paves a new avenue for reducing throttling energy losses and improves system efficiency in hydraulic switching actuators, as well as most of the hydraulic switch-mode circuits.

Stem cells can be used to treat diabetic mellitus and complications. ω3-docosahexaenoic acid (DHA) derived lipid mediators are inflammation-resolving and protective. This study found novel DHA-derived 7S,14R-dihydroxy-4Z,8E,10Z,12E,16Z,19Z-docosahexaenoic acid (7S,14R-diHDHA), a maresin-1 stereoisomer biosynthesized by leukocytes and related enzymes. Moreover, 7S,14R-diHDHA can enhance mesenchymal stem cell (MSC) functions in the amelioration of diabetic mellitus and retinal pericyte loss in diabetic db/db mice. MSCs treated with 7S,14R-diHDHA were delivered into db/db mice i.v. every 5 days for 35 days. Blood glucose levels in diabetic mice were lowered by 7S,14R-diHDHA-treated MSCs compared to control and untreated MSC groups, accompanied by improved glucose tolerance and higher blood insulin levels. 7S,14R-diHDHA-treated MSCs increased insulin+ β-cell ratio and decreased glucogan+ α-cell ratio in islets, as well as reduced macrophages in pancreas. 7S,14R-diHDHA induced MSC functions in promoting MIN6 β-cell viability and insulin secretion. 7S,14R-diHDHA induced MSC paracrine functions by increasing the generation of hepatocyte growth factor and vascular endothelial growth factor. Furthermore, 7S,14R-diHDHA enhanced MSC functions to ameliorate diabetes-caused pericyte loss in diabetic retinopathy by increasing their density in retina in db/db mice. Our findings provide a novel strategy for improving therapy for diabetes and diabetic retinopathy using 7S,14R-diHDHA-primed MSCs.

In this study, nano-diamond (ND) and MoS2 powder are used as additives in a carbonyl iron based magnetorheological fluid (MRF) to improve its tribological performance. MRFs are prepared by dispersing 35 wt.% of CI particles in silicone oil, and adding different proportions (0, 1, 3 or 5 wt.%) of ND and MoS2 additives. Seven kinds of MRFs are made and tested using reciprocating friction and wear tester under different normal loads, and then the friction characteristics are evaluated through analyzing experiment results. The morphology properties of MRFs and contacting surfaces before and after tests are also observed using a scanning electron microscope and analyzed by energy-dispersive X-ray spectroscopy. The results show that the appropriate weight percentage of MoS2 additives may decrease friction coefficient and wear zone. It is also demonstrated from the detailed analyses of worn surfaces that the wear mechanism is influenced not only by additives but also by applied normal load and magnetic field strength.

The meticulously engineered powertrain mounting system of hybrid-electric vehicles plays a critical role in minimizing vehicle vibrations and noise, thereby enhancing the longevity of vital powertrain components. However, developing and designing such a system demands substantial time and financial investments due to intricate analysis and modeling requirements. To tackle this challenge, this study integrates data-mining technology into the design and optimization processes of the powertrain mount system. The research focuses on the powertrain mounting system of a transverse four-cylinder hybrid-electric vehicle, employing the CRISP-DM (Cross-Industry Standard Process for Data Mining) methodology to establish a data-mining prediction model for mounting stiffness. This model utilizes three data mining algorithms—Multi-SVR, MRTs, and MLPR—assessing their predictive accuracy concerning mounting system stiffness estimation. A comparative analysis reveals that the MRTs algorithm outperforms others as the most effective prediction model. The proposed predictive model elucidates the quantifiable correlation between vibration isolation performance and installation stiffness, overcoming complexities associated with traditional modeling approaches. Applying this model in powertrain mounting system design showcases the efficacy of the CRISP-DM-based approach, significantly enhancing design efficiency without compromising prediction accuracy.

In recent years, wireless power transfer (WPT) has progressed rapidly in both theory and commercialization abroad. However, existing research into WPT coil design for low-power devices is limited. This paper investigates coil structure using printed circuit board (PCB) for magnetic resonant coupling WPT to address this gap. Specifically, the impacts of key geometric parameters on the coil quality factor and coupling coefficient are analysed through models and simulations. Equivalent PCB coils were formed for mutual inductance models, and four basic compensation circuits were analysed. The impacts of changes in coil thickness, line width, turn spacing, and number of turns on the quality factor of PCB coils were analysed with a fixed outer diameter of the coil. In this paper, to mitigate the coil offset while retaining PCB manufacturing simplicity for practical uses, a dual layer PCB coil structure is proposed. The structure optimizated PCB coil could offer remarkable improvements in the WPT system for low power electronic devices.

In bioinformatics research, traditional machine learning methods have demonstrated efficacy in addressing Euclidean data. However, real-world data often encompasses non-Euclidean forms, such as graph data, which contain intricate structural patterns or high-order relationships that elude conventional machine-learning approaches. Representation learning seeks to derive valuable data representations from enhancing predictive or analytic tasks, capturing vital patterns and structures. This method has proven particularly beneficial in bioinformatics and biomedicine, as it effectively handles high-dimensional, sparse data, detects complex biological patterns, and optimizes predictive performance. In recent years, graph representation learning has become a popular research direction. It embeds graphs into a low-dimensional space while preserving the structural and attribute information of the graph, enabling better feature extraction for downstream tasks. This study extensively reviews representation learning advancements, particularly in the research of representation methods since the emergence of COVID-19. We begin with an analysis and classification of neural network-based language model representation learning techniques as well as graph representation learning methods. Subsequently, we explore their methodological innovations in the context of COVID-19, with a focus on the domains of drugs, public health, and healthcare. Furthermore, we discuss the challenges and opportunities associated with graph representation learning. This comprehensive review presents invaluable insights for researchers as it documents the development of COVID-19 and offers experiential lessons to preempt future infectious diseases. Moreover, this study guides future bioinformatics and biomedicine research methodologies.

Speech emotion recognition is a critical component for achieving natural human-robot interaction. The modulation-filtered cochleagram is a feature based on auditory modulation perception, which contains multi-dimensional spectral-temporal modulation representation. In this study, we propose an emotion recognition framework that utilizes a multi-level attention network to recognize emotions from the modulation-filtered cochleagram. The channel-level attention and spatial-level attention modules are used to capture emotional saliency maps of channel and spatial feature representations from the 3D convolution feature maps, respectively. Furthermore, the temporal-level attention module captures significant emotional regions from the concatenated feature sequence of the emotional saliency maps. Our experiments on the IEMOCAP dataset demonstrate that the modulation-filtered cochleagram significantly improves the prediction performance of categorical emotion compared to other evaluated features. Moreover, our emotion recognition framework achieves a better unweighted accuracy of 71% in categorical emotion recognition than several existing approaches in the experiments. In summary, our study demonstrates the effectiveness of the modulation-filtered cochleagram in speech emotion recognition, and our proposed multi-level attention framework provides a promising direction for future research in this field.

The current neural networks for tomato leaf disease recognition have problems such as large model parameters, long training time, and low model accuracy. To solve these problems, a lightweight convolutional neural network LBFNet is proposed in this paper.First, a lightweight convolutional neural network LBFNet is established as the base model. Secondly, a three-channel attention mechanism module is introduced to learn the disease features in tomato leaf disease images and reduce the interference of redundant features. Finally, a cascade module is introduced to increase the depth of the model, solve the gradient descent problem, and reduce the loss caused by increasing the depth of the model. The quantized pruning technique is also used to further compress the model parameters and optimize the model performance. The results show that the LBFNet model achieves 99.06% accuracy on the LBFtomato dataset, with a training time of 996s and a single classification accuracy of over 94%. Further training using the saved weight file after quantized pruning makes the model accuracy reach 97.66%. Compared with the base model, the model accuracy was improved by 28%, and the model parameters were reduced by 96.7% compared with the traditional Resnet50. It was found that LBFNet can quickly and accurately identify tomato leaf diseases in complex environments, providing effective assistance to agricultural producers.

Micro-grids’ operations offer local reliability; in the event of faults or low voltage/frequency events on the utility side, micro-grids can disconnect from the main grid and operate autonomously while providing the continued supply of power to local customers. With the ever-increasing penetration of renewable generation, however, the operations of micro-grids become increasingly complicated because of the associated fluctuations of voltages. As a result, transformer taps are adjusted frequently, thereby leading to the fast degradation of expensive tap-changer transformers. In the islanding mode, the difficulties also come from the drop of voltage and frequency upon disconnecting from the main grid. To appropriately model the above, the nonlinear AC power flow constraints are necessary. Computationally, the discrete nature of tap-changer operations and the stochasticity caused by renewables add two layers of difficulty on top of a complicated AC-OPF problem. To resolve the above computational difficulties, the main principles of the recently-developed "l1-proximal" Surrogate Lagrangian Relaxation are extended. Testing results based on 9-bus system demonstrate the efficiency of the method to obtain the exact feasible solutions for micro-grid operations thereby avoiding approximations inherent to existing methods, while demonstrating that through the optimization, 1. the number of tap changes is drastically reduced, and 2. the method is capable of handling networks with meshed topologies.

This study provides a novel method to prepare metal-ceramic composites from magnetically selected iron ore using microwave heating. By introducing three different microwave susceptors (Activated Carbon, SiC, and a mixture of Activated Carbon and SiC) during the microwave process, effective control of the ratio of metallic and ceramic phases has been achieved easily. The effects of the three susceptors on the microstructure of the metal-ceramics and the related reaction mechanisms were also investigated in detail. The results show that the metal phase (Fe) and ceramic phase (Fe2SiO4, FeAl2O4) can be maintained, but the metal phase to ceramic phase changed significantly. In particular, the microstructures appeared as well-distributed nanosheet structures with diameters of ~400 nm and thicknesses of ~20 nm when SiC was used as the microwave susceptor.

Objectives: In order to solve the problem that most of the existing research focuses on the binary tactile attributes of objects,which ignores the tactile attribute strength and category recognition,an attribute strength and category recognition method based on convolutional neural network matrix-label is proposed. Methods:Firstly,in the data preparation stage,we preprocess the raw data and determine the matrix labels to build the haptic dataset.Secondly,in the feature extraction stage,we fuse the haptic data of two fingers and use the convolutional neural network to extract the attribute strength features.Finally,in the attribute strength and category recognition stage,all channel haptic data is fused to predict the attribute strength and category.Results:We compared with the multi-label convolutional neural network method in terms of elastic strength,hardness strength and category,and compared the attribute strength recognition capabilities of the two methods using novel objects outside the haptic dataset.The results show that the accuracy of the last 20 iterations of the matrix-label method has an average elastic strength of 96.73%,hardness strength of 97.34%,and category of 96.67%.The performance is better.When the Euclidean distance between the prediction of the novel object and the real label is less than 1,the accuracy of the elastic strength is best to reach 100%,and the hardness strength is best to reach 100%.The performance is better. Conclusions:The effectiveness of the method has been verified.Comparing with the convolutional neural network method,our method can effectively recognize the attribute strength and category of objects.

In this study, we report a new epoxy acrylate based shape memory polymer(SMP) fabricated by Liquid crystal display (LCD) Stereolithographic 3D printing. The printed 3D object has a high resolution and high transparency in visible light region. The uniaxial tensile tests showed enhanced tensile toughness and tunable mechanical properties. The fix-recovery and cycle tests indicated high shape recovery properties including high shape recovery rate and excellent cycling stability. In addition, a smart electrical valve actuator was fabricated that can be used in fast heat or electricity responsive electrical circuits. LCD 3D printing provides a low-cost and high efficient way to fabricate fast responsive SMP, which can be used in wide applications in various fields on aerospace engineering, biomedical devices, soft robots and electronic devices.

Accurate and efficient traffic incident detection methods can effectively alleviate traffic congestion caused by traffic incidents, prevent secondary accidents and improve the safety of urban road traffic.Aiming at the problems that the traditional machine learning event detection method cannot fully extract the parameter characteristics of traffic flow and is not suitable formulti-dimensional and non-linear massive data, we propose a new traffic event detection method(CNN-XGBoost).This method combines the respective advantages of Convolution Neural Network(CNN) and Extreme Gradation Boosting (XGBoost). Firstly, we preprocessed the original freeway traffic incident detection data set by constructing initial variable set, data normalization, data balance processing and dimension reorganization. Secondly,we use CNN network to automatically extract the deep features of event detection data, and use XGBoost as a classifier to classify the extracted features for expressway traffic event detection.Finally, we use the data set of Hangzhou expressway microwave detector in China to carry out simulation experiments on CNN-XGBoost. The experimental results show that compared with XGBoost, CNN, Support Vector Machine (SVM) and Gradient Boosting Decision Tree (GBDT) and other methods, CNN-XGBoost method can effectively improve the accuracy of expressway traffic event detection and has better generalization ability.

In this paper, a voice coil motor (VCM) actuated fast tool servo (FTS) system is developed for diamond turning. To guide motions of the VCM actuator, a crossed double parallelogram flexure mechanism is selected featuring totally symmetric structure with high lateral stiffness. To facilitate the determination of the multi-physical parameters, analytical models of both electromagnetic and mechanical systems are developed. The designed FTS with balanced stroke and natural frequency is then verified through the finite element analysis. Finally, the prototype of the VCM actuated FTS is fabricated and experimentally demonstrated to have a stroke of ±59.02 μm and a first natural frequency of 253 Hz. By constructing a closed-loop control using PID controller with the internal-model based resonant controller, the error for tracking a harmonic trajectory with ±10 μm amplitude and 120 Hz frequency is obtained to be ±0.2 μm, demonstrating the capability of the FTS for high accuracy trajectory tracking.

This study was conducted to determine the dynamic effects of dietary crude protein (CP) intake on nitrogen (N) balance, ileal amino acid digestibility, and gene expression levels of digestive enzymes at three stages in pigs. In Experiment 1, 18 growing pigs (average body weight (BW) = 9.5 kg) were randomly assigned to one of three treatments (n = 6/treatment group), including normal (20% CP), low (17% CP), and very low (14% CP) protein intake. In Experiment 2, 18 growing pigs (average BW = 30 kg) were allotted randomly to one of three treatments (n = 6/treatment group), including normal (18% CP), low (15% CP), and very low (12% CP) protein intake. In Experiment 3, 18 growing pigs (average BW = 45 kg) were assigned randomly to one of three treatments (n = 6/treatment group), including normal (16% CP), low (13% CP), and very low (10% CP) protein intake. Growing pigs fed the 14% CP and 17% CP diets had lower final BW (P < 0.05) and average daily gain (ADG) (P < 0.05) compared to pigs fed the 20% CP diet. Reducing the dietary CP level from 20 to 14% decreased urinary N excretion by 52.8% (P < 0.001) in Experiment 1. Reducing the dietary CP level from 18 to 12% decreased urinary N excretion by 55.3% (P < 0.001) and reduced fecal N excretion by 34% (P < 0.05) in Experiment 2. Reducing the dietary CP level from 16 to 10% decreased urinary N excretion by 56.4% (P < 0.001) and fecal N excretion by 47.1% (P < 0.001) in Experiment 3. Pigs fed the very low (14%, 12%, and 10% CP) diets showed higher digestibility for CP (P < 0.05), His (P < 0.05), Ile (P < 0.05), Phe (P < 0.05), Thr (P < 0.05), Trp (P < 0.05), Glu (P < 0.05), and Ser (P < 0.05) compared to pigs fed the normal (20%, 18%, and 16% CP) diets among the three experiments. Pigs fed the very low (14%, 12%, and 10% CP) diets showed higher mRNA levels for chymotrypsin C (P < 0.01 in Experiment 1 and 2; P < 0.05 in Experiment 3) compared to pigs fed the normal (20%, 18%, and 16% CP) diets among the three experiments. These results indicated that a reduction in dietary CP by 6% limited the growth performance of growing pigs, and a reduction of dietary CP by 3% supplemented with essential amino acids could reduce the excretion of N into the environment without affecting weight gain.

With advances in next-generation sequencing(NGS) technologies, large number of multiple types of high-throughput genomics data are available. A great challenge in exploring cancer mechanism is to identify the driver genes from the mutation genes by analyzing and integrating multi-types genomics data. Breast cancer is known as a heterogeneous disease. The identification of subtype-specific driver genes is critical to guide the diagnosis, assessment of prognosis and treatment of breast cancer. We developed an integrated frame based on gene expression profilings and copy number variation(CNV) data to identify breast cancer subtype-specific driver genes. In this frame, we employed statistical machine-learning method to select gene subsets and utilized an module-network analysis method to identify potential candidate driver genes. The final subtype-specific driver genes were acquired by paired-wise comparison in subtypes. To validate specificity of the driver genes, the gene expression data of these genes were applied to classify the patient samples with 10-fold cross validation and the enrichment analysis were also conducted on the identified driver genes. The experimental results show that the proposed integrative method can identify the potential driver genes and the classifier with these genes acquired better performance than with genes identified by other methods.

The pathogen Cryptococcus neoformans is a major cause of fungal meningitis in humans. As with other melanotic microorganisms associated with human diseases, the cell wall-associated melanin of C. neoformans is a major virulence factor that contributes to its ability to evade host immune responses. The levels of melanin substrate and the regulation of melanin formation could be influenced by the microbiota-gut-brain axis. Moreover, recent studies show that C. neoformans infection causes dysbiosis in the human gut microbiome. In this review, we discuss the potential association between cryptococcal meningitis and the gut microbiome. Additionally, we emphasize the promising prospects of targeting the gut microbiome as a means of diagnosing and treating this debilitating disease.

Urumqi City, located in the northwest of China, is a city with high indoor radon concentration in nationwide indoor radon survey in China. This study focuses on the assessment of indoor radon level and its potential sources in this city. Indoor radon measure using RAD7 and solid nuclear track detector (SSNTD), soil gas radon by RAD7 and determining specific activity of uranium and radium in soil samples by a high pure germanium spectrometer were performed from 2021 to 2023. The results reveal a wide range of indoor radon concentrations in Urumqi, with anomalies above 400 Bq/m3 in some dwellings. The arithmetical and geometric mean values of indoor radon concentration in Urumqi are 90.24 ± 83.04 Bq/m3 and 66.25 Bq/m3, respectively. The geometric mean values of radon and thoron by SSNTD is 110 Bq/m3 and 109 Bq/m3. The analysis suggest that the activity of faults and fault structures are the main factors influencing indoor radon levels, with frequent earthquakes contributing to higher average radon concentrations. Additionally, investigations into indoor radon and building material radioactivity in detailed are recommended for buildings with radon anomalies and the source of indoor radon anomalies.

In the Versatile Video Coding (VVC) standard, affine motion models have been applied to enhance the resolution of complex motion patterns. However, due to the high computational complexity involved in affine motion estimation, real-time video processing applications face significant challenges. This paper focuses on optimizing affine motion estimation algorithms in the VVC environment and proposes a fast gradient iterative algorithm based on edge detection for efficient computation. Firstly, we establish judging conditions during the construction of affine motion candidate lists to streamline the redundant judging process. Secondly, we employ the Canny edge detection method for gradient assessment in the affine motion estimation process, thereby enhancing the iteration speed of affine motion vectors. Experimental results demonstrate that our affine motion estimation algorithm reduces encoding time by approximately 15%-35% while maintaining video bitrate and quality.

In recent years, the FDA has approved numerous antitumor drugs that are mutation-based for clinical use. These drugs have improved the precision of treatment and reduced adverse effects and side effects. Personalized therapy is a prominent and hot topic of current medicine and also represents the future direction of development. With the continuous advancements in gene sequencing and high-throughput screening, research and development strategies for personalized clinical drugs have developed rapidly. This review elaborated the recent personalized treatment strategies, which include artificial intelligence, multi-omics analysis, chemical proteomics, and computation aided drug design. These technologies rely on the molecular classification of diseases, the global signaling network within organisms, and new models for all targets, which significantly support the development of personalized medicine. Meanwhile, we summarized chemical drugs such as lorlatinib, osimertinib, and other natural products that deliver personalized therapeutic effects based on genetic mutations. This review also highlights potential challenges in interpreting genetic mutations and combining drugs, while providing new ideas for the development of personalized medicine and pharmacogenomics in cancer study.

Early diagnosis and treatment have always been highly desired in the fight against cancer, and detection of circulating tumor DNA (ctDNA) has recently been touted as highly promising for early cancer screening. Consequently, the detection of ctDNA in liquid biopsy gains much attention in the field of tumor diagnosis and treatment, which has also attracted research interest from the industry. However, traditional gene detection technology is difficult to achieve low cost, real-time and portable measurement of ctDNA. Electroanalytical biosensors have many unique advantages such as high sensitivity, high specificity, low cost and good portability. Therefore, this review aims to discuss the latest development of biosensors for minimal-invasive, rapid, and real-time ctDNA detection. Various ctDNA sensors are reviewed with respect to their choices of receptor probes, detection strategies and figures of merit. Aiming at the portable, real-time and non-destructive characteristics of biosensors, we analyze their development in the Internet of Things, point-of-care testing, big data and big health.

Men are more likely to develop cancer than women. In fact, male predominance is one of the most consistent cancer epidemiology findings. Additionally, men have a poorer prognosis and an increased risk of secondary malignancies compared to women. These differences have been investigated in order to better understand cancer and to better treat both men and women. In this review, we discuss factors that may cause this gender difference, focusing on urothelial bladder cancer (UBC) pathogenesis. We consider physiological factors that may cause higher male cancer rates, including differences in X chromosome gene expression. We discuss how androgens may promote bladder cancer development directly by stimulating bladder urothelium and indirectly by suppressing immunity. We are particularly interested in natural killer (NK) cells because they are important, but often overlooked anti-cancer lymphocytes.

Microfluidics is facing critical challenges in the quest of miniaturizing, integrating, and automating in vitro diagnostics, including the increasing complexity of assays, the gap between the macroscale world and the microscale devices, and the diverse throughput demands in various clinical settings. Here a “3D extensible” microfluidic design paradigm that consists of a set of basic structures and unit operations was developed for constructing any application-specific assay. Four basic structures- check valve (in), check valve (out), double-check valve (in and out), and on-off valve, were designed to mimic basic acts in biochemical assays. By combining these structures linearly, a series of unit operations can be readily formed. We then proposed a “3D extensible” architecture to fulfill the needs of the function integration, the adaptive “world-to-chip” interface, and the adjustable throughput in the X, Y, and Z directions, respectively. To verify this design paradigm, we developed a fully integrated loop-mediated isothermal amplification microsystem that can directly accept swab samples and detect Chlamydia trachomatis automatically with a sensitivity one order higher than that of the conventional kit. This demonstration validated the feasibility of using this paradigm to develop integrated and automated microsystems in a less risky and more consistent manner.

In order to study the crystallinity of different density polyethylenes, the experimental study on the transformation of the conductance mechanism under high electric field was carried out. The X-ray Diffraction(XRD), Different Scanning Calorimeter(DSC), Direct Current(DC) breakdown of Low-density polyethylene(LDPE), Linear low density polyethylene(LLDPE), Medium density polyethylene(MDPE) and High-density polyethylene(HDPE) and the electric field of 5-200kV/mm were tested. Conductivity characteristics experiments, in addition, using the mathematical formula of a variety of conductance mechanisms, the electric field-current density curves of the four kinds of polyethylene were fitted to analyze the conductance transition of the above four kinds of polyethylene in non-ohmic regions under different high field strengths. mechanism. The experimental results show that as the density of polyethylene increases, the crystallinity increases continuously, and the continuous increase of crystallinity causes the electric conduction flow under the same field strength to decrease significantly. The field strength corresponding to the two turning points in the conductance characteristic curve increases simultaneously. Large, the breakdown field strength increases; through analysis, it is found that in the high field, as the electric field increases, the conductance mechanism develops from the ohmic conductance of the low field strength region to the bulk effect of the high field strength region (Poole-Frenkel). Then the electrode effect to the high field strength (Schottky), and the threshold field strength of this conductance mechanism transition increases with the increase of crystallinity.

Fault line detection timely and accurately when single-phase-to-earth fault occurs in resonant grounding system is still a focus of research. This paper presents a new approach for fault detection based on data fusion and it has non-artificial setting. Firstly, the fault criterion for interphase difference energy ratio and time-frequency correlation coefficient of each line is proposed. Subsequently, the paper establish a coordinate system with the interphase difference energy ratio as X axis and the time-frequency correlation coefficient as Y axis, and it uses the Euclidean distance algorithm to get the characteristic distance of each line by fusing two-dimensional information. Finally, comparing the sound distance and the fault distance of each line to discriminate the fault line. Electromagnetic Transients Program (EMTP) simulation results and adaptability analysis have confirmed the effectiveness and reliability of the proposed scheme.

The surface planarity and asperity removal behaviors of atomic scale under the ultrathin water environment was studied for the nanoscale process by molecular dynamics simulation. The monolayer atomic removal was achieved under the noncontact and monoatomic layer contact conditions with different water film thickness, and the newly formed surface is relatively smooth and no deformed layer and plastic defects exist. The nanoscale processing is governed by the interatomic adhering action during which the water film transmits the loading forces to Cu surface and thereby result in the migration and removal of surface atoms. With scratching depth ≥ 0.5 nm, the abrasive particle squeezed out the water film from scratching region and scratched Cu surface directly, leading to the surface quality deterioration mainly governed by the plowing action. This study brings the goals of “0 nm planarity, 0 residual defects and 0 polishing pressure” closer to us in the nanoscale process for the development of ultra-precision manufacture technology.

Potato tubers are susceptible to wounding during post-harvest processes, leading to quality decline, perishability and large economic losses. In this study, the potato cultivar, ‘Longshu No.7’, was foliar-sprayed with 3% chitosan (w/v) three times during the pre-harvest period after flowering to evaluate the effect of foliar spraying with chitosan on suberization processing at wounds of harvested potato tubers. Our results demonstrate that foliar-sprayed with chitosan significantly reduced wound-induced fresh weight loss and dry rot disease index by 37.34% and 41.60% on the 28 day after wounding, respectively. Foliar-sprayed with chitosan accelerated the deposition of suberin polyphenolics and lignin at the wound sites of potato tubers with the formation of thicker cell layers. This occurred with increased localized activities of key enzymes in the suberin polyphenolics and lignin pathways, including phenylalanine ammonia lyase, 4-coumaryl-coenzyme A ligase, cinnamyl alcohol dehydrogenase and peroxidase (33.90–64.32%), as well as the contents of cinnamic acid, sinapic acid, flavonoids, lignins and total phenolics (19.70–23.46%) at wound sites of potato tubers on the 7 day after wounding. Our results indicated that foliar application of chitosan accelerated wound-induced suberization of potato tubers and could mitigate post-harvest product damages.

Plant height is significantly correlated with grain traits, which is a component of wheat yield. The purpose of this study is to investigate the main QTLs that control plant height and grain-related traits in multiple environments. In this study, we constructed a high-density genetic linkage map using the Wheat50K SNP Array to map quantitative trait loci (QTLs) for these traits in 198 recombinant inbred lines (RILs). The two ends of the chromosome were identified as re-combination-rich areas in all chromosomes except chromosome 1B. The middle area of the chro-mosomes was identified as the recombination-barren area. Both the genetic map and the physical map showed a significant correlation when p=0.001, with a correlation coefficient between 0.63 and 0.99. However, there was almost no recombination between 1RS and 1BS. In terms of plant height, 1RS contributed to the reduction of plant height by 3.43cm. In terms of grain length, 1RS contributed to the elongation of grain by 0.11mm. A total of 43 QTLs were identified, including 8 QTLs for Plant height(PH), 11 QTLs thousand grain weight(TGW), 15 QTLs for grain length(GL),and 9 QTLs for grain width(GW), which explained 1.36%–33.08% of the phenotypic variation. Seven were environment-stable QTLs, including two loci Qph.nwafu-4B and Qph.nwafu-4D that determined plant height. The explanation rates of phenotypic variation were 7.39%-12.26% and 20.11%-27.08%, respectively. One QTL, Qtgw.nwafu-4B, which influenced TGW, showed an explanation rate of 3.43%-6.85% for phenotypic variation, two co-segregating KASP markers were developed, the physical locations corresponding to KASP_AX-109316968 and KASP_AX-109519968 were 25.888344 MB and 25.847691 MB. Another QTL, Qgw.nwafu-4D, which determined grain width, had an explanation rate of 3.43%-6.85%. Three loci that affected the grain length were Qgl.nwafu-5A, Qgl.nwafu-5D.2 and Qgl.nwafu-6B, illustrating the explana-tion rates of phenotypic variation as 6.72%-9.59%, 5.62%-7.75%, and 6.68%-10.73%, respectively. Two QTL clusters were identified on chromosomes 4B and 4D.