The Industrial Internet of Things (IIoT) is bringing evolution with remote monitoring, intelligent analytics, and control of industrial processes. A reference architecture provides the general layout information for the flexible integration of IIoT systems; however, as the industrial world is currently in its initial stage of adopting the full-stack development solutions with IIoT, some challenges need to be addressed. To cope with the rising challenges and provide the blueprint guidelines to develop and implement IIoT in real-time, researchers around the globe have proposed IIoT architectures based on different architectural layers and emerging technologies. In this paper, we first review and compare some widely accepted IIoT reference architectures and present a state-of-the-art review of conceptual and experimental IIoT architectures in literature. We highlight scalability, interoperability, security, privacy, reliability, and low latency as the main IIoT architectural requirements and compare how the current architectures address these challenges. We also highlight the role of emerging technologies in current IIoT architectures to address these requirements and present the literature gap for future research work to address the challenges.

LSU (RESPONSE TO LOW SULFUR) proteins belong to a plant-specific gene family initially characterized by their strong induction in response to sulfate (S) deficiency. However, little is known about the LSU gene repertoire and evolution of this family in land plants. In this work, a total of 270 LSU family members were identified using 134 land plant species with whole genome sequence available. Phylogenetic analysis revealed that LSU genes belong to a Spermatophyta-specific gene family, and their homologs are distributed in three major groups, two for dicotyledons and one group for monocotyledons. Moreover, we analyzed the expression of LSU genes in one representative species of each phylogenetic group (wheat, tomato and Arabidopsis) and found a conserved response to S-deficiency, suggesting that these genes might play a key role in S stress responses. Accordingly, Arabidopsis lsu2 knockout mutant plants showed increased levels of internal sulfate content and lower levels of expression of different key genes involved in S deficiency and metabolism like SDI2 and APR3. In summary, our results indicate that LSU genes are evolutionarily conserved in angiosperms and that specific members of this family might play an important role regulation of S transport and assimilation.

The transmission and analysis of data is one of the challenges of the 21st century. In the field of environmental measurement technology, existing broadband and wireless technologies have not been able to transmit data reliably and cost-effectively over long distances and in hard-to-reach places. LoRaWAN, an IoT technology, could be an energy-efficient, cost-effective and secure alternative as a narrowband technology in combination with battery-powered sensors and thus make an important contribution to the intelligent, largely wireless networking of objects, plants and machines (IoT), for example in the municipal sector. In addition to ecological and economic benefits, the quality of life in modern, intelligently networked cities can be enhanced by real time data acquisition. However, the prerequisite is that the quality of the data acquired via this method is sufficiently good. This paper therefore addresses the question of the quality of particulate matter data collected by low-cost sensors. To determine this, an SDS011 particulate matter sensor from Nova Fitness was ported to LoRaWAN. The sensor was installed next to a governmental measurement station. In a test that lasted five weeks, data from the SDS011 sensor were compared with those from the governmental station. Differences were identified and a correction approach was developed and applied. The efficiency of the approach was verified. Based on the results, it can be seen that the use of the low cost sensors has weaknesses. Problems can only be partially reduced. Nevertheless, the use of the low-cost sensors can be helpful for a flexible and cost effective collection of environmental data.

Back pain is a common symptom that affects all age groups across the globe, when left untreated may eventually lead to disability. A convenient sample selection method was used in this study due to the global Covid-19 pandemic lockdown which was effective in Turkey during the investigation period. Thus, virtual data collection and health education including some health risks were employed. A total population of two hundred adult women was involved in the study but one hundred and twenty-one responses were collected. Findings show that, for socio-demographic characteristics, the pain was found highest in women between the ages of 41-50 and obese/overweight individuals. Although, there was no significant difference recorded in the marital status category. Moreover, statistical mean differences were detected between the scales for ODI (4.18) and BPFS (6.09). Also, p<0.05, paired sample t-test was 0.001 ODI and 0.001 BPFS after the training exercise. This suggests that exercise training is inversely correlated with pain severity which implies that training has a significant influence on pain intensity. Thus, it could be concluded that there is a relationship between the training exercise and ODI/BPFS.

The circuitry of the summarized "floating" differential stages (FDS) based on complementary field-effect transistors with a control p-n junction (CJFET), intended for use in low-noise analog microcircuits, for example, operational amplifiers. The results of modeling the flow characteristics of one of the CJFET FDSs in the LTSpice XVII environment at low temperatures (down to -197 ⁰С) and exposure to a neutron flux in the range of 1e13 ÷ 1e15 n / cm² are presented.

High-penetration of Distributed Energy Resources (DER) in low voltage distribution grids, mainly photovoltaics (PV), might lead to overvoltage in the point of common coupling. Volt-VAr is one of the common control functions for DER power converters used to enhance the stability and the reliability of the voltage in the distribution system and, thus, fulfilling the network operator requirements. In this study, a centralized algorithm will provide local Volt-VAr control parameters to each PV inverter, based on the electrical grid characteristics where each equipment is installed. Since accurate information of grid characteristics is typically not available, the parametrization of the electrical grid is done using power meter data in DER location and a voltage sensitivity matrix. The algorithm has different optimization modes to both minimize voltage deviation and line current. In order to validate the effectiveness of the algorithm and its deployment in real infrastructure, it has been tested in an experimental setup with PV emulators in a set of 5-day tests. Volt-VAr control algorithm successfully adapted its parameters based on grid topology and PV inverter characteristics, achieving a voltage reduction up to 25% of the allowed voltage deviation.

Statistical machine translation (SMT) which was the dominant paradigm in machine translation (MT) research for nearly three decades has recently been superseded by the end-to-end deep learning approaches to MT. Although deep neural models produce state-of-the-art results in many translation tasks, they are found to under-perform on resource-poor scenarios. Despite some success, none of the present-day benchmarks that have tried to overcome this problem can be regarded as a universal solution to the problem of translation of many low-resource languages. In this work, we investigate the performance of phrase-based SMT (PB-SMT) and NMT on two rarely-tested low-resource language-pairs, English-to-Tamil and Hindi-to-Tamil, taking a specialised data domain (software localisation) into consideration. This paper demonstrates our findings including the identification of several issues of the current neural approaches to low-resource domain-specific text translation and rankings of our MT systems via a social media platform-based human evaluation scheme.

Low back pain (LBP) is a pandemic and costly musculoskeletal condition in the United States. Patients with LBP may endure surgery, injections, and expensive visits to emergency departments. Some suggest that using physical therapy or chiropractic in the earlier stage of LBP reduces the utilization of expensive health services and lowers the treatment costs. Nevertheless, there is no consistent evidence to declare which one of these methods is a cost-effective treatment within a short (less than a year) period of time. The purpose of this study was to investigate the cost-effectiveness of chiropractic versus physical therapy in the United States. A decision tree analytic model was used for estimating the economic outcomes. The findings showed that in the chiropractic group, the total average cost was $48.56 lower than the physical therapy group, and daily adjusted life years (DALY) was 0.0043 higher than the physical therapy group. Chiropractic care was shown to be a cost-effective alternative compared with physical therapy for adults with at least three weeks of low back pain over six months.

In Low and Lower-Middle-Income countries, the prevalence of anemia in infancy remains high. In early childhood anemia cause irreversible cognitive deficits and represents a higher risk of child mortality. The consequences of anemia in infancy are a major barrier to overcome poverty traps. The aim of this study was to analyze based on a multi-level approach, different factors associated with anemia in children 6–23 m old based on recent available Standard Demographic Health Surveys (S-DHS). We identified 52 S-DHS that had complete information in all covariates of interest in our analysis between 2005 and 2015. We performed traditional logistic regressions and multilevel logistic regression analyses to study the association between hemoglobin concentrations and household, child, maternal, socio-demographic variables. In our sample, 70 % of the 6–23 m old children were anemic. Child anemia was strongly associated with maternal anemia, household wealth, maternal education and low birth weight. Children fed with fortified foods, potatoes and other tubers had significantly lower rates of anemia. Improving overall household living conditions, increasing maternal education, delaying childbearing and introducing iron rich foods at six months of age may reduce the likelihood of anemia at in toddlerhood.

Motivated by diffraction experiments on the $\left(2\sqrt{3}\times \sqrt{3}\right)\mathrm{R}{30}^{\circ }$ reconstructed Si(111) due to deposition of rare earth elements (Dy, Tb) and silicide formation we analyse the splitting and non-splitting of superstructure spots. For this purpose, we model diffraction patterns for one dimensional structures generated by the binary surface technique and use supercell models to keep the analysis simple. Diffraction pattern are calculated in the framework of the kinematical diffraction theory and they are analyzed as a function of the domains and domain boundaries. Basic properties of the diffraction pattern are analyzed for model systems of a two-fold and a three-fold periodicity. The rules derived from these calculations are applied to the "real-world" system of Si(111)-($\left(2\sqrt{3}\times \sqrt{3}\right)\mathrm{R}{30}^{\circ }$)-RESi$2_{}$ (RE = Dy or Tb). Depending on the combination of domains and domain boundaries of different types a plethora of different features are observed in the diffraction patterns. These are analyzed to determine the sizes of both domain boundaries and domains from experimentally observed splitting of specific superstructure spots.

Background: The Advanced Lung Cancer Inflammation Index (ALI) is a novel, comprehensive index that integrates inflammation and nutritional status, incorporating parameters such as albumin, body mass index (BMI), and the neutrophil-to-lymphocyte ratio (NLR). Unlike traditional inflammation biomarkers, this study aims to evaluate the prognosis of IPF patients by considering both inflammation and nutritional status. Method: A total of 102 patients with IPF were included in the study. Clinical data were obtained from the patients' medical records. NLR and ALI score were calculated based on data collected at the initiation of antifibrotic treatment using the following formula: Neut/Lym and albumin × BMI / NLR. Results: IPF subject subgroups in terms of ALI based on gender–age–physiology (GAP) stages (1,2,3), FVC (median split,

Nitraria tangutorum Bobrov is a berry shrub with white flowers and red fruits, which grows in the deserts in the Tibetan Plateau, Mongolia, and western China. Its fruit N. tangutorum fruit (NTF) contains various bioactive compounds, with anti-fatigue, anti-inflammatory, and neuroprotective functions. However, the high saccharide content of NTF makes it unsuitable for diabetic patients. In this study, we fermented NTF to obtain N. tangutorum fermented juice (NTJ), and N. tangutorum fermented residue (NTR), which are suitable for diabetics to consume. We characterized the bioactive compounds in NTF, NTR, and NTJ, and found that fermentation increased the diversity of bioactive compounds, and greatly reduced sucrose, glucose, and fructose content while generating trehalose, which has the potential to manage blood glucose levels. Further, NTJ displays anti-diabetic potential due to various compounds anti-diabetic properties. This study provides a basis for further clinical research on NTJ's anti-diabetic function in humans.

Since the photocatalytic reaction is a surface reaction, enhancing the gas movement around photocatalyst would promote photocatalytic CO₂ reduction performance. A new approach to enhance the gas movement around the photocatalyst by the natural thermosiphon movement of gasses around photocatalyst using black body material was proposed and confirmed experimentally, but the heat transfer mechanism on the phenomena was not clarified yet. The purpose of this study is to clarify the heat transfer mechanism of it. This study calculated the temperature of mixed gases of CO₂ and NH₃ around P₄O₁₀/TiO₂ photocatalyst by the heat transfer formula. It is revealed that there was no difference between the increase temperature (T_g) from the temperature at the beginning of the CO₂ reduction experiment (T_ini) and the temperature of mixed gases of CO₂ and NH₃ measured by thermocouple in the experiment (T_e) under the illumination condition with a visible light (VIS) + an infrared light (IR) and IR only. The heat transfer model proposed by this study has predicted T_g well under the illumination condition with VIS + IR and IR only well. On the other hand, it is revealed that the difference between T_g and T_e was as large as 10 ℃ under the illumination condition with an ultra violet light (UV) + VIS + IR.

A recent research has identified an inverse amplitude link between obliquity damping and short eccentricity amplification during Mid-Late Pleistocene based on LR04 δ18O and equatorial Pacific Site 846 sea surface temperature records, which is associated with the Earth's long-term cooling. In the present study, new evidence of this anticorrelation is presented from Antarctic D-CO2-CH4 records, global benthic-planktic δ18O, and regional (Atlantic, Pacific, Mediterranean, and Indian) climate-related proxies. Based on a critical review of theoretical constrains (Earth's oblateness changes and ice-volume phase lag in the obliquity band <5.0 kyr), this widespread and symmetric (bipolar) obliquity response damping has been interpreted as an effect of the obliquity-oblateness feedback, which could be the latent physical mechanism at the origin of the Mid-Pleistocene Transition (MPT). Indeed, results and considerations of the present work suggest that fast and positive/negative net variation of the Earth's oblateness in the obliquity band was controlled by dominant glacio-eustatic water mass component and, assuming a rapid response of the ice-volume to surface temperature changes, the mean obliquity lag response is estimated to be <5.0 kyr over the past 800 kyr. These elements may explain the interglacial/glacial damping observed in the obliquity response. The consolidation of the Earth's long-term icy-state in the subtrend IV, culminated with the post-MPT obliquity damping, might have contributed to the strengthening of the short eccentricity response by mitigating the obliquity ‘ice-killing’ during obliquity maxima (interglacials), favouring the obliquity-cycle skipping and a feedback amplified ice-growth in the short eccentricity band (obliquity damping hypothesis). This could suggest a different impact of the climate friction than what is generally believed, which is presumably the latent physical mechanism that triggers transient ‘competitive’ interaction between obliquity and short eccentricity started early during the Piacenzian.

Differences between the quantum mechanical and relativistic concepts of time are explained by using the equivalence principle. The resulting clock model calls for microscopic equations of motion to be formulated in Minkowski space, and for photons to be described as four-dimensional localizations of field. Because the properties of energy are universal the equations have been extended to include galaxies in spite of vast differences in lifetime. The comparison is possible due to a fundamental symmetry based on the conjugate variables energy and time.

Abstract Tetraspanin CD63 is a cluster of cell surface proteins with four transmembrane domains which associates with tetraspanin-enriched microdomains and typically localizes to late endosomes and lysosomes. CD63 plays an important role in cellular trafficking of different proteins, EV cargo sorting and vesicles formation. We have preciously shown that CD63 is important in LMP1 trafficking to EVs and this also affects LMP1 mediated intracellular signaling including MAPK/ERK, NF-κB and mTOR activation. Using the BioID combined with mass spectrometry, we sought to define the broad CD63 interactome and how LMP1 modulates this network of interacting proteins. We identified a total of 1600 total proteins as proximal interacting newtwork of proteins to CD63. Biological process enrichment analysis revealed significant involvement in signal transduction, cell communication, protein metabolism and transportation. The CD63 only interactome was enriched in Rab GTPases, SNARE proteins and sorting nexins while adding LMP1 into the interactome increased presence of signaling and ribosomal proteins. Our results showed that LMP1 alters the CD63 interactome, shifting the network of proteins enrichment from protein localization and vesicle mediated transportation to metabolic processes and translation. We also show that LMP1 interacts with mTor, Nedd4L and PP2A indicating formation of a multiprotein complex with CD63 thereby potentially regulating LMP1 dependent mTor signaling. Collectively, the comprehensive analysis of CD63 proximal interacting proteins provides insights into network of partners required for endocytic trafficking, extracellular vesicle cargo sorting, formation and secretion.

We aimed to explore university students’ perceptions and experiences of SARS-CoV-2 mass asymptomatic testing, social distancing and self-isolation during the COVID-19 pandemic. This qualitative study comprised of four rapid online focus groups conducted at a higher education institution in England during high alert (tier 2) national COVID-19 restrictions. Data were analysed thematically. Participants were purposively sampled university students (n = 25) representing a range of gender, age, living circumstances (on/off campus) and SARS-CoV-2 testing/self-isolation experiences. Six themes with 16 sub-themes emerged from the analysis of the qualitative data: ‘Term-time Experiences’, ‘Risk Perception and Worry’, ‘Engagement in Protective Behaviours’, ‘Openness to Testing’, ‘Barriers to Testing’ and ‘General Wellbeing’. Students described feeling safe on campus, believed most of their peers are adherent to protective behaviours and were positive towards asymptomatic testing in university settings. University communications about COVID-19 testing and social behaviours need to be timely and presented in a more inclusive way to reach groups of students who currently feel marginalised. Barriers to engagement with SARS-CoV-2 testing, social distancing and self-isolation were primarily associated with fear of the mental health impacts of self-isolation, including worry about how they will cope, high anxiety, low mood, guilt relating to impact on others and loneliness. Loneliness in students could be mitigated through increased intra-university communications and a focus on establishment of low COVID-risk social activities to help students build and enhance their social support networks. These findings are particularly pertinent in the context of mass asymptomatic testing programmes being implemented in educational settings and high numbers of students being required to self-isolate. Universities need to determine the support needs of students during self-isolation and prepare for the long-term impacts of the pandemic on student mental health and welfare support services.

NASA mission systems proposals are often compared using an equivalent system mass (ESM) framework wherein all elements of technology to deliver an effect- its components, operations and logistics of delivery- are converted to effective masses since this has a known cost scale in space operations. To date, ESM methods and the tools for system comparison have not considered complexities wherein systems that serve a mission span multiple transit and operations stages, such as would be required to support a crewed mission to Mars, and thus do not account for the different mass equivalency factors operational during each period and the inter-dependencies of the costs across the mission. Further, ESM does not account well for the differential reliabilities of the underlying technologies. Less reliability should incur an equivalent mass cost for technologies that might otherwise provide a mass advantage. We introduce an extensions to ESM to address these limitations and show that it provides a direct method for analyzing, optimizing and comparing different mission systems. We demonstrate our extended ESM (xESM) calculation with crop production technologies -- an aspect of the developing offworld biomanufacturing suite -- since it represents a case with strong coupling among stages of the mission and a relatively high-risk profile.

Fractional-time Schrödinger equation (FTSE) describes the evolution of quantum processes endowed with memory effects. FTSE manifestly breaks all consistency requirements of quantum field theory (unitarity, locality and compliance with the clustering theorem), unless the order of fractional differentiation and integration ( ) falls close to the standard index . Working in the context of the minimal fractal manifold (where , ), we confirm here that FTSE approximates the attributes of gravitational metric and provides an unforeseen generation mechanism for massive fields.

Man-made shallow fishponds in the Czech Republic have been facing a high eutrophication since 1950s. Anthropogenic eutrophication and feeding of fish have strongly affected the physico-chemical properties of water and its aquatic community composition leading to harmful algal bloom formation. In our current study, we have characterised the phytoplankton community across three hypertrophic ponds to assess the phytoplankton dynamics during the vegetation season. We microscopically identified and quantified 29 cyanobacterial taxa comprised of non-toxigenic and toxigenic species. Further, a detailed cyanopeptides (CNPs) profiling was performed using molecular networking analysis of liquid chromatography tandem mass spectrometry (LC–MS/MS) data coupled with dereplication strategy. This MS networking approach coupled with dereplication on online global natural product social networking (GNPS) web platform led us to putatively identify forty CNPs: fourteen anabaenopeptins, ten microcystins, five cyanopeptolins, six microginins, two cyanobactins, a dipeptide radiosumin, a cyclooctapeptide planktocyclin and epidolastatin12. We have applied the binary logistic regression to estimate the CNPs producer by correlating the GNPS data with the species abundance. Usage of The combination of molecular networking and dereplication on online global natural product social networking (GNPS) web platform has proved as a valuable approach for rapid and simultaneous detection of high number of peptides, and rapidly assessing the risk for harmful bloom.

The simultaneous evaluation of heat/mass transference procures momentous significance in the polymer industry and engineering activities. Extensive utilization of such aspects includes propylene flares, heat exchangers, energy transfiguration in chilling towers, and amputation of post fortuitous heat in nuclear reactors. Owing to such prospective demands, we interpreted the Jeffrey liquid reactive flow under non-linear convection. We scrutinized the transference of heat/mass under generalized Fourier-Fick relations. Thermal conductivity depends on temperature while mass diffusivity is dependent on concentration. Besides, heat source along with first-order chemical reaction aspects are accounted for. Relevant transformations are exerted to achieve non-linear differential systems that are solved through the homotopy scheme. Influences of divers factors are exhibited via graphical benchmark.

Corona viruses hijack human enzymes to assembly sugar coat on Spike glycoproteins. The mechanism that human antibodies may uncover the antigenic viral peptide epitopes hidden by sugar coat are unknown. In this study, we analyzed recombinant SARS-CoV-2 Spike protein secreted from BTI-Tn-5B1-4 cells, by trypsin and chymotrypsin digestion followed by mass spectrometry analysis. We acquired MS/MS spectrums for glycopeptides of all 22 predicted N-glycosylated sites. We further analyzed the surface accessibility of Spike proteins according to Cryo-EM and homolog-modeled structures, and available antibodies that bind to SARS-CoV-1. The results showed that all 22 N-glycosylated sites of SARS-CoV-2 are modified by high-mannose type of N-glycans. MS/MS fragmentation clearly established the glycopeptide identities. Electron densities of glycans cover most of the Spike receptor binding domain of SARS-CoV-2, except YQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQ, similar to a region FSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQ in SARS-CoV-1. Other surface-exposed domains included those located on Central Helix, between amino acids 967 and 1016 of SARS-CoV-1, and 985 to 1034 of SARS-CoV-2 Spike protein. As the majority of antibody paratopes bind to peptide portion with or without sugar modification, we propose a snake-catcher model that a minimal length of peptide is first clamped by a paratope, and the binding is either strengthened by sugars close to peptide, or not interfered by sugar modification.

We suggest that momentum should be rede ned in order to help make physics more consistent and more logical. In this paper, we propose that there is a rest-mass momentum, a kinetic momentum, and a total momentum. This leads directly to a simpler relativistic energy momentum relation. As we point out, it is the Compton wavelength that is the true wavelength for matter; the de Broglie wavelength is mostly a mathematical artifact. This observation also leads us to a new relativistic wave equation and a new and likely better QM. Better in terms of being much more consistent and simpler to understand from a logical perspective.

Improving air quality and reducing human exposure to unhealthy levels of airborne chemicals are important global missions, particularly in China. Satellite remote sensing offers a powerful tool to examine regional trends in NO2, thus providing a direct measure of key parameters that strongly affect surface air quality. To accurately resolve spatial gradients in NO2 concentration using satellite observations and thus understand local and regional aspects of air quality, a priori input data at sufficiently high spatial and temporal resolution to account for pixel-to-pixel variability in the characteristics of the land and atmosphere are required. In this paper, we adapt the Berkeley High Resolution product (BEHR v3.0A, v3.0B and v3.0C) and meteorological outputs from the Weather Research and Forecasting (WRF) model to describe column NO2 in southern China. The BEHR approach is particularly useful for places with large spatial variabilities and terrain height differences such as China. We retrieved tropospheric NO2 vertical column density (TVCD) within part of southern China, for four seasons of 2015, based upon satellite datasets from Ozone Monitoring Instrument (OMI). Retrieval results are validated by comparing with MAX-DOAS tropospheric column measurements conducted in Guangzhou. BEHR retrieval algorithms are more consistent with MAX-DOAS measurements than OMI-NASA retrieval, opening new windows into research questions that require high spatial resolution, for example retrieving NO2 vertical column and ground pollutant concentration in China and other countries.

This paper introduces an approach that chooses the fault detection by calculating probabilities using probability mass function (pmf) and cumulative distribution function (CDF). This work used a method for multiple stuck-at faults by producing a new test pattern in combinational circuits. We assumed that existence of all multiple faults is only because of one single component that is faulty. A complete test set can be created by all possible single stuck-at faults in a combinational circuit using some combination of gates. The test set generation fault detection method is applied on two different 3-bit input variable and 4-bit input variable circuits. The probability of error occurrence is calculated at both 3-bit and 4-bit input variable circuits. The resulting feature is used to obtain maximum error occurrence probability to detect faults by the logic used that the complexity of the circuit is inversely proportional to the fault occurrence probability. Then again, undetectability is directly proportional to the complexity of the circuit. Therefore, finest feasible circuit should have large input variable components with less complexity to reduce the fault occurrence probability.

Almond is worldwide consumed and renowned as a valuable healthy food. In spite of this, it is also a potent source of allergenic proteins able to trigger several mild to life-threatening immunoreactions. Food processing proved to alter biochemical characteristics of proteins, thus affecting the respective allergenicity. In this paper we investigated the effect of autoclaving, preceded or not by a hydration step, on the biochemical and immunological properties of almond proteins. Any variation in the stability and immunoreactivity of almond proteins extracted from the treated materials, were evaluated by total protein quantification, ELISA assay and protein profiling by electrophoresis-based separation (SDS-PAGE). The autoclaving alone was found to weakly affect almond proteins stability, despite what observed for the combination of hydration and autoclaving, which resulted in a loss of approximately 70% of total protein content compared to untreated sample, and in a final negligible immunoreactivity, as well. The final SDS-PAGE protein pattern recorded for almonds hydrated and autoclaved disclosed significant changes. In addition, the same samples were further submitted to in vitro simulated gastro-duodenal (GI) digestion to evaluate potential changes induced by these processing on allergens digestibility. Digestion products were identified by HPLC-HRMS/MS analysis followed by software-based data mining, and complementary information were provided by analyzing the proteolytic fragments lower that 6 kDa in size. The autoclave based treatment was found not to alter the allergens digestibility, whereas an increased susceptibility to proteolytic action of digestive enzymes was observed in almonds subjected to the combination of prehydration and autoclaving. Finally, the residual immunoreactivity of the GI resistant peptides was investigated in-silico by bioinformatic tools, confirming that by following both approaches, no epitopes survived the almond digestion, thus demonstrating the potential effectiveness of these treatments to reduce almond allergenicity.

The blue sepal color of hydrangea is due to a metal complex anthocyanin composed of 3-O-glucosyldelphinidin (1) and an aluminum ion with the co-pigments 5-O-caffeoylquinic acid (2) and/or 5-O-p-coumaroylquinic acid (3). The three components, namely, anthocyanin, Al³⁺ and 5-O-acylquinic acids, are essential for blue color development, but the complex is unstable and only exists in aqueous solution. Furthermore, the complex did not give analyzable NMR spectra or crystals. Therefore, many trials to determine the detailed chemical structure of the hydrangea-blue complex have failed to date. Instead, via experiments mixing 1, Al³⁺ and 2 or 3 in a buffered solution at pH 4.0, we obtained the same blue solution derived from the sepals. However, the ratio was not stoichiometric but fluctuated. To determine the composition of the complex, we tried direct observation of the molecular ion of the complex using electrospray-ionization mass spectrometry. In a very low-concentration buffer solution (2.0 mM) at pH 4.0, we reproduced the hydrangea-blue color by mixing 1, 2 and Al³⁺ in ratios of 1:1:1, 1:2:1 and 1:3:1. All solution gave the same molecular ion peak at m/z = 843, indicating that the blue solution has a ratio of 1:1:1 for the complex. By using 3, the observed mass number was m/z = 827 and the ratio of 1, 3 and Al³⁺ was also 1:1:1. A mixture of 1, 3-O-caffeoylquinic acid (4) and Al³⁺ did not give any blue color but instead was purple, and the intensity of the molecular ion peak at m/z = 843 was very low. These results strongly indicate that the hydrangea blue-complex is composed of a ratio of 1:1:1 for 1, Al³⁺ and 2 or 3.

Background: Oxytocin is recommended as the first-line choice for labor induction in term pregnant women with premature rupture of membranes (PROM); however, it can occasionally lead to failed induction and delivery complications. The primary objective of this study was to compare delivery information and outcomes following the administration of oxytocin infusion or oral low-dose misoprostol solution for labor induction in term PROM women with an unfavorable cervical condition. Methods: A prospective nested case-control study was conducted at a tertiary general hospital in China from March 2020 to February 2024, comparing oxytocin infusion and oral administration of 25ug misoprostol every 2 hours for labor induction in term PROM women with a Bishop score

A fundamental aspect in the evolution of Time-to-Digital Converters (TDCs) implemented within Field-Programmable Gate Arrays (FPGAs), given the increasing demand for detection channels, is the optimization of resource utilization. This study reviews the principal methodologies employed for implementing low-resource TDCs in FPGAs. It outlines the foundational architectures and interpolation techniques utilized to bolster TDC performances without unduly burdening resource consumption. Low-resource Tapped Delay Line, Vernier Ring Oscillator, and Multi-Phase Shift Counter TDCs, including the use of SerDes, are reviewed. Additionally, novel low-resource architectures are scrutinized, including Counter Gray Oscillator TDCs and interpolation expansions using Voltage-Temperature-Consumption stable IODELAYS. Furthermore, the advantages and limitations of each approach are critically assessed, with particular emphasis on resolution, precision, non-linearities, and, especially, resource utilization. A comprehensive summary table encapsulating existing works on low-resource TDCs is provided, offering a comprehensive overview of the advancements in the field.

The unprecedented progress in Artificial Intelligence (AI), particularly in deep learning algorithms with ubiquitous internet connected smart devices, has created a high demand for AI computing on the edge devices. This review studied commercially available edge processors, and the processors that are still in industrial research stages. We categorized state-of-the-art edge processors based on the underlying architecture, such as dataflow, neuromorphic, and Processing in-Memory (PIM) architecture. The processors are analyzed based on their performance, chip area, energy efficiency, and application domains. The supported programming frameworks, model compression, data precision, and the CMOS fabrication process technology are discussed. Currently, most of the commercial edge processors utilize dataflow architectures. However, emerging non-von Neumann computing architectures have attracted the industry in recent years. Neuromorphic processors are highly efficient for performing computation with fewer synaptic operations, and several neuromorphic processors offer online training for secured and personalized AI applications. This review found that the PIM processors show significant energy efficiency and consume less power compared to dataflow and neuromorphic processors. The future direction of the industry would be to implement state-of-the-art deep learning algorithms in emerging non-Von Neumann computing paradigms for low power computing on the edge devices.

Mortality in children accounts for 15% of all AIDS-related deaths globally, with a higher burden among Cameroonian children (25%), likely due to poor virological response. We sought to evaluate viral suppression (VS) and its determinants in a nationally representative paediatric and young adult population receiving antiretroviral therapy (ART). A cross-sectional and multicentric study was conducted among Cameroonian children (

Great Himalayan range with regions namely, Jammu & Kashmir, Ladakh and high altitude parts of north eastern states inherently experience high solar exposure, cold, arid climate and significantly challenging geography. With a scarcity of affordable public housing projects in these regions a grid enabled low energy residential prototype is proposed having the capability to operate on nearly zero consumption of heating and cooling energy with the application of indigenous and contemporary energy efficient passive design techniques. Preliminary study, development of design and reading of simulation results were applied for the performance and benefit analysis of the low energy building prototype. Analysis of the climatic zone further classified and narrowed the design criterion by confirming upon beneficial architectural components proven to be energy efficient. These architectural components include, optimization of direct solar gain and orientation of building envelope, modified trombe wall system, traditional sunrooms, solar chimney with openable vents, efficient spatial planning and compliance of relevant parameters such as window-wall-ratio (WWR). The proposed low energy housing for the economically weaker section is estimated to save nearly 50% of active fuel based household heating energy. Site has been planned in such a way that about 100% of required electricity can be generated from on site renewable energy for the proposed infrastructure, it is proven more beneficial if additional electricity is generated to offset the power supply and result in lower or subsidized electricity bills. Design is compliant to different codes relevant to energy conservation and low-income housing with an embodied carbon of about 1.2 kgCO2/m2 per dwelling unit giving ‘A’ grade in cradle to gate impacts. The findings and performance of this prototype can serve as a guideline for energy efficient design in low income group housing situated in severe cold and arid regions of India such as Ladakh (U.T.).

Background: The objectives were to evaluate: the safety and immunogenicity of nonavalent human papillomavirus (nHPV) vaccine in adult Spanish women living with HIV (WLHIV); the prevalence of anal and cervical dysplasia and nHPV vaccine genotypes in anus and cervix; and risk factors for high-risk HPV (HR-HPV) infection in anal mucosa. Methods In this single-center, open-arm, non-randomized clinical trial, nHPV vaccine was administered at 0, 2, and 6 months to WLHIV enrolled between February 2020 and November 2023, measuring vaccine antibody titers pre-vaccination and at 2, 6, and 7 months after the first dose. Cervical and anal cytology and HPV PCR genotyping studies were performed. Women with abnormal cytology and/or anal or cervical HPV infection at baseline underwent high-resolution anoscopy and/or colposcopy. Results: 122 participants were included with mean age of 49.6 years: 52.5% smoked; 10.7% had anal-genital condylomatosis; 38.5% infection by HR-HPV in anus and 25.4% in cervix, most frequently HPV-16; 19.1% had AIN1 and 3.1% CIN1 and CIN2. Vaccine administration did not modify viral-immunological status (CD4 [809±226.8 cells/uL vs. 792.35 ±349.95; p=0.357]) or plasma HIV load (3.38±4.41 vs. 1.62±2.55 cop/uL [log]; p=0.125). Anti-HPV antibodies ([IQR: 0-0] vs. 7.63 nm [IQR: 3.46-19.7]; p=0.0001) and seroconversion rate (8.2% vs. 96.7% [p=0.0001]) were increased at 7 versus 0 months. There were no severe vaccine-related adverse reactions; injection-site pain was reported by around half of participants. HR-HPV infection in anus was solely associated with concomitant cervix infection (HR 5.027; 95% CI: 1.009-25.042). Conclusions: nHPV vaccine in adult WLHIV is immunogenic and safe.

A regional modern river-sand geochemical mapping study in the majority of the Timor-Leste territory, including the research area, has not been previously reported. This study demonstrated the potential of modern river sand geochemical mapping as an effective method for lithological mapping, particularly in areas that face challenges in conducting efficient geological fieldwork and have limited geological information. A total of 53 modern river sand samples were collected and analyzed. Before examining the samples using wavelength-dispersive X-ray fluorescence for ten major elements, the loss-on-ignition method was employed. In the Clerec drainage basin, SiO2, CaO, and K2O showed positive correlations, and CaO was positively correlated with MnO. Similarly, in the Sahe River catchment, a positive relationship was observed between CaO, MnO, and TiO2. These findings suggested the presence of quartz, manganese, secondary K-bearing minerals, and secondary Ti-bearing minerals in carbonate rocks that have undergone silicification and other alteration processes. The principal component analysis results corroborated the SiO2/Al2O3 and K2O/Na2O ratios and the ICV findings. PC1 was related to the variations in Ca-poor and Ca-rich rocks; PC2 indicated notable inputs from SiO2-rich and SiO2-poor rocks; and PC3 revealed the possibility of contributions from secondary mineral assemblages related to silicification and low-grade metamorphic processes.

This study determines the equivalent stress intensity factor (SIF) model that best fits the experimental behavior of low-carbon steel under mixed mode (I and II). The study assessed Tanaka, Richard, and Pook's equivalent SIF models. The theoretical values used for comparison correspond to experimental results in a modified C(T) geometry by machining a hole ahead of the crack tip subjected to fatigue loads with a load ratio of R = 0.1. The comparison involved the SIF for six experimental points and the values computed through the numerical simulation. The Paris, Klesnil, and modified Forman-Newman crack growth models were used with each equivalent SIF to analyze the prediction in the estimated number of cycles. The Klesnil model showed the closest prediction since the error between the calculated and experimentally recorded number of cycles is the lowest. However, the material behavior reflects a reduced crack propagation rate attributed to plasticity in the crack tip. Results suggest that Asaro equivalent SIF conservatively estimates the element lifespan with increasing errors from 2.3% at the start of growth to 27 % at the end of the calculation.

Severe COVID-19 alters the biochemical and morphological characteristics of blood cells in a wide variety of ways. To date, however, the vast majority of research has been devoted to the study of leukocytes, while erythrocyte morphological changes have received significantly less attention. The purpose of this research was to identify erythrocyte types that were unique to COVID-19, compare the number of different poikilocyte types, and measure erythrocyte sizes to provide data on size dispersion. Red blood cells obtained from 6 control donors (800-2200 cells for each donor) and 5 COVID-19 patients (800-1900 cells for each patient) were examined using low voltage scanning electron microscopy. We did not discover any forms of poikilocytes that would be unique to COVID-19. Among COVID-19 patients, we observed an increase in the number of acanthocytes (p=0.01) and a decrease in the number of spherocytes (p=0.03). In addition, our research demonstrates that COVID-19 causes an increase in the median (p=0.004) and interquartile range (p=0.009) when assessing erythrocyte size.

A fluorescent probe, N'-((3-methyl-5-oxo-1-phenyl-4, 5-dihydro-1H-pyrazol-4-yl) methylene)-2-oxo-2H-chromene-3-carbohydrazide (MPMC), was synthesized and characterized. Characterizations of the synthetic MPMC were conducted by proton nuclear magnetic resonance (1HNMR) spectroscopy and carbon-13 nuclear magnetic resonance spectroscopy (13C NMR). The fluorescence emission behaviors of probe MPMC towards diverse metal ions were detected and the probe exhibited high sensitivity and selectivity towards Cu2+ over other metal ions via quenching of its fluorescence. Furthermore, the existence of other metal actions made no difference on the fluorescence intensity of the MPMC-Cu2+ system apparently, that is, MPMC displayed a good anti-interference ability. Job’s plot of MPMC and copper ions indicated the detection limit was 15.16 nM (R2=0.9612) for the assayed actions, with a stoichiometric ratio of 1:1 for MPMC and Cu2+. Additionally, the color of MPMC probe solution changed from nearly colorless to yellow in the presence of Cu2+ in visible light, which the color change could be observed by the naked eye. Similarly, the color resolved bright yellow into blue in ultraviolet light. Also reusability studies indicated that MPMC probe was reusable. The pH effect of probe MPMC to Cu2+ had a broad range of pH detection 4.0 to 11.0. The response time of MPMC probe for determining Cu2+ was within 1 min. The recognition of Cu2+ by MPMC performed on pre-treated paper under sunlight and UV light both had a distinct colour change. Thus, the solid-state method for detecting Cu2+ with the naked-eye, was both economical and convenient.

This article presents a study conducted within a wind tunnel to enhance understanding of the excitation mechanism of stay cable vibration under arid conditions. Numerous wind tunnel tests were meticulously analyzed. Initially, the vibration of the stay cable was measured under steady flow conditions at a flow angle of 45 degrees and an inclination of 25 degrees, while varying wind velocities were applied. Additionally, an investigation into the flow field surrounding the stay cable was conducted in both vertical and horizontal directions. By utilizing two hot wire anemometers in the cable wake, an extensive database of flow field measurements was obtained. The experimental results revealed that the vibration characteristics of the stay cable under the arid conditions considered in this study aligned with findings reported in existing literature. Notably, a deeper comprehension of the excitation mechanism of a stay cable in a dry state was attained. This mechanism is closely associated with the inhibition of Karman vortices and the development of low-frequency vortices. At low wind speeds, Karman vortices predominated, resulting in small-amplitude vibrations. However, as the wind speed increased, the influence of Karman vortices diminished progressively, while the low-frequency vortices grew stronger. These low-frequency vortices exhibited high energy and a significant correlation with shedding along the stay cable, thereby inducing cable vibration in a dry environment.

To accomplish IMO's emissions reduction targets, the Chinese government has established emission control areas and implemented strict sulfur limitation policies. Faced with the downturn in the shipping industry and the challenge of insufficient supply of compliant fuel, Hong Kong and Shenzhen in China have implemented different low-sulfur fuel subsidy policies. Therefore, it is particularly important to study the air pollution control mechanism considering low sulfur fuel subsidy policy. Firstly, the non-cooperative game models considering low-sulfur fuel subsidies are constructed. Secondly, the mechanisms of various factors affecting port pricing, throughput and profit are analyzed. Then, a case study is conducted by using AIS data of container ships in Shanghai Port and Ningbo Zhoushan Port. The study reveals that whether the container service price of the leader port increases or decreases, the follower port always take corresponding follow-up measures. In both sequential and simultaneous game, the profit difference of the leader port is positively related to the subsidy ratio of the port’s own and negatively related to the coefficient of the competitor's subsidy. In conclusion, the low-sulfur fuel subsidy policy has a significant positive impact on the step-by-step implementation of more stringent pollution reduction policies in port waters.

This paper presents a proposal for a non-isolated bidirectional converter (NIBC) controlled by a deep neural network (DNN) to enable vehicle-to-vehicle (V2V) and vehicle-to-grid (V2G) charging, which contributes to the development of more efficient and sustainable transportation and energy systems. The DNN controller manages power flow in both directions, making it possible to charge electric vehicles (EVs) and discharge power from EVs to the grid with improved efficiency and performance compared to traditional control methods. The non-isolated topology used in this proposal offers several benefits, including reduced cost, smaller size, and higher efficiency. To train the DNN controller, a large dataset of simulations was used, and the results were validated with a hardware setup. The real-time performance of the DNN controller was compared to a proportional-integral (PI) based controller through simulated results. The findings of the study show that the DNN controller outperforms traditional PI controllers.

We explored the outcomes of germline BRCA1/2 pathogenic/likely pathogenic variants (PVs/LPVs) in the endocrine-sensitive disease treated with first line standard of care cyclin-dependent kinase 4/6 (CDK4/6) inhibitors. Three studies retrospectively showed a reduction in overall survival (OS) and progression free survival (PFS) in gBRCA1/2m patients compared to both germinal BRCA1/2 wild type (gBRCA1/2wt) and to the untested population. Regarding the efficacy of PI3K inhibitors, there are no subgroup or biomarker analyses in which germinal BRCA status was explored. However, the biological interactions between the PIK3CA/AKT/mTOR pathway and BRCA1/2 at a molecular level could help us to understand the activity of these drugs when used to treat BC in BRCA1/2 PVs/LPVs carriers. The efficacy of trastuzumab deruxtecan (T-DXd), an antibody-drug conjugate (ADC) targeting HER2 for HER2-low and HER2-positive (HER2+) BC, has been increasingly described. Unfortunately, data on T-DXd in HER2+ or HER2-low metastatic BC harboring germinal BRCA1/2 PVs/LPVs is lacking. Including germinal BRCA1/2 status in the subgroup analysis of the registration trials of this ADC would be of great interest, especially in the phase III trial DESTINY-breast04. This trial enrolled patients with HER2-negative (HER2-) and both HR+ and HR- metastatic disease, which can now be categorized as HER2-low. The HER2-low subgroup includes tumors that were previously classified as triple negative, so it is highly likely that some women were germline BRCA1/2 PVs/LPVs carriers and this data was not reported. Germline BRCA1/2 status will be available for a higher number of individuals with BC in the near future and data on the prognostic and predictive role of these PVs/LPVs is needed in order to choose the best treatment options.

The Direction-of-Arrival (DoA) estimation methods are highly versatile and find extensive applications in satellite communication. The DoA methods are employed across a range of orbits, from Low Earth Orbits (LEO) to Geostationary Earth Orbits (GEO). They serve multiple applications, including altitude determination, geolocation and estimation accuracy, target localization, and relative and collaborative positioning. This paper presents a novel approach for modeling the DoA angle using a closed-form expression, incorporating the boresight angle and satellite and Earth station position data. The method uses the geographic coordinate system in the satellite communication system, precisely the latitude and longitude of the Earth station and altitude parameters of the satellite stations, to calculate the Earth station’s elevation angle and accurately model the DoA angle. Furthermore, this paper performs a comprehensive comparative analysis of various DoA methods to gain deeper insights into the performance of DoA estimation in multi-antenna systems operating under spatially correlated channels. Accordingly, this paper evaluates DoA estimation performance using root-mean-square-error (RMSE) statistics for uplink and downlink conditions through extensive Monte Carlo simulations. The simulation’s effectiveness is validated against the Cramer-Rao Bound (CRB) performance metric for the Additive white Gaussian noise (AWGN) case. (i.e., thermal noise). The simulation results demonstrate improved RMSE performance in satellite systems by incorporating spatial correlation into the system model.

Hydro generator sets serve as the peak and frequency regulation of the power system,and play a very important role in maintaining system stability and improving power quality.Based on the internal characteristics model of a specific type of hydro generator,this paper constructs a hydroelectric coupling model for hydropower units,studies the influence of the regulation system of hydropower units on low-frequency oscillations under different load conditions,and adopts variable speed reaching law and fuzzy sliding mode control strategy to improve the regulation quality of the system and ensure the stable operation of the units.Results of simulation and water turbine set under different load conditions show that varible speed reaching law can effectively improve the power-angle oscillation behavior of the hydropower set and suppress the occurrence of low-frequency oscillations of the system when the system is subject to power disturbance,which provide a new theoretical basis and solution for the vibration analysis and control optimization of hydraulic turbine units.

An extended classification of active RC- and RLC- filters with Sallen-Key architectures, including those created in the last three years, is proposed. This makes it possible to formulate new design directions for an extended family of active RC- and RLC- Sallen-Key filters (PF, LPF, HPF, RF) for the tasks of high-speed and ultra-fast analog-to-digital signal conversion.

Ensuring a protection scheme in DC distribution is more difficult to achieve against pole-to-ground fault than in AC distribution system because of the absence of zero crossing points and low line impedance. To complement the major obstacle of limiting the fault current, several compositions have been proposed related to mechanical switching and solid-state switching. Among them, solid-state circuit breakers(SSCBs) are considered a possible solution to limit fast fault current. However, they may cause problems in circuit complexity, reliability and cost-related troubles due to the use of multiple power semiconductor devices and additional circuit configuration to commutate current. This paper proposes the SSCB with a coupled inductor(SSCB-CI) which has symmetrical configuration. The circuit is comprised of passive components like commutation capacitors, a CI and damping resistors. Thus, proposed SSCB-CI offers the advantages of simple circuit configuration and fewer utilized power semiconductor devices than another typical SSCBs in LVDC microgrid. For analysis, six operation states are described for the voltage across main switches and fault current. The effectiveness of the SSCB-CI against a short-circuit fault is proved via simulation and experimental results in a lab-scale prototype.

A high proportion of dogs and cats are fearful during veterinary visits, which in some cases may escalate into aggression. Here, we discuss factors that contribute to negative emotions in a veterinary setting and how these can be addressed. The set-up of the waiting area (e.g. spatial dividers; elevated places for cat carriers), tailoring the examination and the treatment to the individual, considerate handling (minimal restraint when possible, avoiding leaning over or cornering animals) and offering high-value food or toys throughout the visit can promote security and, ideally, positive associations. Desensitisation and counterconditioning are highly recommended both to prevent and address existing negative emotions. Some negative experiences such as short-term pain from injections can be minimised by using tactile and cognitive distractions. Preemptive analgesia is recommended for known painful procedures. Recommendations for handling fearful animals to minimise aggressive responses are discussed. However, anxiolytics or sedation should be used whenever there is a risk of traumatising an animal or for safety reasons. Stress-reducing measures can decrease stress and fear in patients and consequently their owners – thus strengthening the relationship with the clients as well as increasing the professional satisfaction of veterinary staff.

Background: Low-level physical activity (PA) among Chronic Low Back Pain (cLBP) is associated with various biopsychosocial factors. This research aimed to study the predictors of PA behavior among cLBP patients. Methods: In the present study 300 eligible patients with cLBP who referred to comprehensive health service centers in the Shahid Beheshti University of Medical Sciences (SBUMS) in Tehran, Iran were random selected.To diagnose the predictors of PA behavior, all the Theory of Reasoned Action (TRA) constructs were examined as risk factors to see if they influence on the probability of PA behavior occurrence and were interpreted through odds ratio (OR). SPSS version 19 was used to analyze the data. Results: Totally 280 cLBP patients with mean age of 57.07 ±13.09 years old participated in the study. This study showed that motivation to comply significant predictor the cLBP patients for subjective norm OR (%95CI): 2.095(0.116-2.792), p-value<0.001), intention was significant predictor for perform the PA behavior OR (%95CI): 1.431(0.138-1.538), p-value <0.001), behavior beliefs could predictor for attitude OR (%95CI): 1.276(0.106-1.355), p-value= 0.002). attitude, normative beliefs, subjective norm ,and evaluation outcome behavior could predictors the cLBP patients for intention to perform the PA behavior OR (%95CI): 1.188(0.032-1.312), p-value<0.001)., OR (%95CI): 1.158(0.076-2.208), p-value=0.003) ., OR (%95CI): 1.104(0.076-1.128), p-value<0.001) ., OR (%95CI): 0.814(0.301-1.440), p-value=0.007). Conclusions: This study showed that the cLBP patients who were normative beliefs and evaluation regarding PA behavior could effect on the intention to engage in greater PA than those via other constructs (attitude and subjective norm). This study showed that the cLBP patients who were normative beliefs and evaluation regarding PA behavior could effect on the intention to engage in greater PA than those via other constructs (attitude and subjective norm). This study showed that the cLBP patients who were normative beliefs and evaluation regarding PA behavior could effect on the intention to engage in greater PA than those via other constructs (attitude and subjective norm).

Green infrastructure systems are often overdesigned. This may be a byproduct of static sizing (e.g., accounting for a design storm’s runoff volume but not exfiltration rates) or may be deliberate (e.g., buffering against performance loss through time). Regardless, overdesign may compromise plants’ access to water in systems where soil pits are embedded in infiltration beds. It could raise the storm size required for water to reach soil pits, reducing water availability between storms, which could ultimately induce plant physiological stress. This study investigated the hydrological dynamics and water relations of a tree trench system suspected to have been overbuilt and identified factors contributing to, compounding, and mitigating the risk of plant stress. Results provided strong evidence that the abovementioned processes played out. Water in the infiltration bed reached soil pits only once in three years, with that event occurring during a hydrant release. Moreover, minimal water was retained in the soil pit during the event due to the hydraulic properties of the soil media. Through a growing season, one of the two tree types frequently experienced water stress, while the other did so only rarely. These contrasting responses can likely be attributed to roots either being largely confined to the soil pits or reaching a deeper water source. Implications of these results for green infrastructure design are considered.

The solution of structural problems with nonlinear material behaviour in a model order reduction framework is investigated in this paper. In such a framework, greedy algorithms or adaptive strategies are interesting as they adjust the reduced order basis (ROB) to the problem of interest. However, these greedy strategies may lead to an excessive increase in the size of the reduced basis, i.e. the solution is no more represented in its optimal low-dimensional expansion. Here, an optimised strategy is proposed to maintain, at each step of the greedy algorithm, the lowest dimension of the PGD basis using a randomised SVD algorithm. Comparing to conventional approaches such as Gram-Schmidt orthonormalisation or deterministic SVD, it is shown to be very efficient both in terms of numerical cost and optimality of the reduced basis. Examples with different mesh densities are investigated to demonstrate the numerical efficiency of the presented method.

Thermal stresses belong to the leading factors that influence low-temperature cracking behavior of asphalt pavements. During winter, when temperature drops to significantly low values, tensile thermal stresses develop as a result of pavement contraction. Creep test methods can be suitable for the assessment of low-temperature properties of asphalt mixtures. To evaluate the influence of creep test methods on the obtained low-temperature properties of asphalt mixtures, three point bending and uniaxial tensile creep tests were applied and the master curves of stiffness modulus were analyzed. On the basis of creep test results, rheological parameters describing elastic and viscous properties of the asphalt mixtures were determined. Thermal stresses were calculated and compared to tensile strength of the material to obtain the failure temperature of the analyzed asphalt mixtures. It was noted that lower strain values of creep curves were obtained for the Tensile Creep Test (TCT) than for the Bending Beam Creep Test (BBCT), especially at lower temperatures. Results of thermal stress calculations indicated that higher reliability was obtained for the viscoelastic Monismith method based on the TCT results than for the simple quasi-elastic solution of Hills and Brien. The highest agreement with the TSRST results was also obtained for the Monismith method based on the TCT results. No clear relationships were noted between the predicted failure temperature and different methods of thermal stress calculations.

As a result of the cancer immunotherapy revolution hundreds of clinical trials of the newly approved immunotherapies are now under way to improve responses. Not unexpectedly, the 2018 Nobel Prize in Physiology or Medicine was awarded to James P. Allison and Tasuku Honjo for their development of cancer therapy by blockade of co-inhibitory signals. While success stories of terminal cancer patients achieving complete remissions are accumulating, not enough research has been done into the risks of the new therapies. Since the use of immunotherapy is becoming more common, and is expected to develop into first- and second-line treatments, immunotoxicity and autoimmunity are emerging as the nemesis of immunotherapy. Immune-related adverse events (IrAEs) could affect any tissue, their incidence may reach up to 90% of patients and toxicity is dose-dependent. While the combination of two immune checkpoint inhibitors (ICIs) increased efficacy, the incidence of severe adverse events was also increased. Apparently, ICIs cannot be restricted to the targeted anti-tumor T cell population. The long lasting objective of cancer regression can only be achieved by paying a price: tolerance to healthy self tissues is compromised. In the face of an ipilimumab induced pan-lymphocytic activation, a therapeutic paradigm shift is required. The task is not desperately trying to put the genie back in the bottle by immune suppressive treatments, but instead harnessing the autoimmune forces by an off label low-dose combined anti-CTLA-4 and anti-PD1 antibody blockade, which is supplemented with conventional interleukin-2 stimulation and hyperthermia. The proof-of-principle of the low-dose-combination therapy was demonstrated in a heavily pre-treated triple negative breast cancer (TNBC) patient with far advanced pulmonary metastases and severe shortness of breath, who had exhausted all conventional treatment. Her pulmonary metastases went into complete remission with transient WHO I-II diarrhea and skin rash. She lived for 27 months after starting the low-dose-combination therapy. She had recurrence as a sternal mass and pleural metastases up to 3 cm. Since the low-dose-combination protocol consists only of approved drugs and treatments, this exceptional response should instigate further research efforts.

We have successfully measured amyloid beta (Aβ) (1-40) protein added in human serum by a NiCr strain gauge cantilever biosensor immobilized with liposomes incorporating cholesterol. Importantly, we investigated the effect of incorporation of cholesterol in the liposome in order to suppress the interaction between the liposome and many different proteins included in human serum. It was revealed that incorporating cholesterol suppresses the interaction between the proteins other than Aβ in human serum and the liposome. Finally, we detected Aβ(1-40) in human serum with typical chronological behaviors due to Aβ aggregation and fibrillization. Furthermore, as a digital low-pass filtering procedure could reduce external noises, the cantilever sensor immobilized with liposome incorporating cholesterol can detect low-concentrated Aβ in human serum.

It is an utmost importance to characterize drug candidates as early in the development pipeline as possible. Appropriate application of the emerging high throughput analytical techniques unlocks the opportunities to obtain experimental data for in vitro absorption, distribution, metabolism and elimination (ADME) profiling of large compound libraries which is crucial for selection of lead compounds. In an usual scenario, only one drug candidate will be selected from thousands of early compounds based on several stability and screening results. A high to medium throughput screening approaches could significantly accelerates the subsequent research and production phases. Traditionally, the analysis of metabolic stability assays heavily relies on high throughput LC-MS/MS techniques to meet with the lead profiling demands. In this study presented an innovative experimental approach that can offer a refreshing alternative. Laser Assisted Rapid Evaporative Ionization Mass Spectrometry (LA-REIMS) is a quick and efficient method for characterizing complex biological samples without laborious sample preparation and chemical separation. Therefore, using an automated LA-REIMS well plate reader as fast as 8 seconds per sample, we assessed the oxidative metabolic stability of active agents using biomimetic metalloporphyrin-based oxidative model reactions at various pH for commercially available drug substances and compared stability measurements with traditional HPLC-DAD-MS results.

Debt collection companies buy overdue debts on the market in order to collect them and recover the highest possible amounts of a debt. The pursuit of debt recovery by employees of collection agencies is a very demanding task. The aim of the article is to propose a rule-based model for managing the process of mass debt collection in a debt collection company, which will make the debt collection process more efficient. To achieve this, we have chosen a decision tree as a machine learning technique best suited for creating rules based on extensive data from the debt collection company. The classification accuracy of the decision tree, regardless of the possibility of acquiring rule-based knowledge, proved to be the highest among the tested machine learning methods, with an accuracy rate of 85.5%. Through experiments, we generated 16 stable rules to assist in the debt collection process. The proposed approach allows for the elimination of debts that are difficult to recovery at the initial stage of recovery process and to decide whether to pursue amicable debt collection or to escalate the debt recovery process to legal action. Our approach also enables the determination of specific actions during each stage of the proceedings. Abandoning certain actions or reducing their frequency will alleviate the burden on collection agency employees and help avoid the typical burnout associated with this line of work. This is the path to making the organizational culture of a collection agency more sustainable. Our model confirms also the possibility of using data from debt collection companies to automatically generate procedural rules and automate the process of purchasing and collecting debts. However, this would require a larger set of attributes than what we currently possess.

The introduction of Maritime Autonomous Surface Ship (MASS) through the development of autonomous navigation technologies is expected to bring about new technologies, new vessel types, and new job roles such as remote operation center (ROC) and remote operator (RO). The MASS Code are currently being discussed through Maritime Safety Committee (MSC) of International Maritime Organization (IMO). This code is expected to be adopted in the form of non-mandatory guidelines until 2025, with the goal of establishing mandatory requirements by 2028. Additionally, revisions to the International Convention on Standards of Training, Certification and Watchkeeping for Seafarers (STCW) related to crew training and qualifications are planned for adoption by 2027, which will include requirements for MASS operators. This paper aims to examine the fundamental competencies required for safe MASS operation by remote operators using the Analytic Hierarchy Process (AHP) method, considering the emergence of the new profession of RO. Building upon the 66 Knowledge, Understanding &amp; Proficiencies (KUPs) outlined for marine officer in the STCW Convention, the study seeks to identify the additional competencies necessary for RO and contribute to the development of a training model for the future.

The growing adoption of electric propulsion systems in Maritime Autonomous Surface Ships (MASS) necessitates advancements in shipboard electronics for safe, efficient, and reliable operation. These advancements are crucial for tasks like real-time sensor data processing, control algorithms for autonomous navigation, and robust decision-making capabilities. This study investigates research trends in MASS using bibliographic analysis to inform policy and future research directions in this evolving field. We analyze 3,363 MASS-related articles from the Web of Science database, employing co-occurrence word analysis and latent Dirichlet allocation (LDA) topic modeling. Findings reveal a rapidly growing field dominated by image recognition research. Keywords like "datum," "image," and "detection" suggest a focus on collecting and analyzing marine data, particularly with deep learning for synthetic aperture radar imagery. LDA confirms this, with "Image analysis and classification research" as the leading topic. The study also identifies national and organizational leaders in MASS research. However, research on Arctic routes lags behind other areas. This work provides valuable insights for policymakers and researchers, promoting a deeper understanding of MASS and informing future policy and research agendas for the integration of electric propulsion systems in the maritime industry.

The aim of this study is to solve the problems of complicated pretreatment and high analytical cost in the detection technology of trace drug toxicants in municipal wastewater. A high-performance magnetic sorbent was synthesized for enrichment of trace drug substances in wastewater to develop magnetic solid-phase extraction pretreatment combined with the acoustic ejection mass spectrometry (AEMS) analytical methods for the molecules in wastewater drug toxicants. The magnetic nanospheres was successfully prepared by magnetic nanoparticles modified with divinylbenzene and vinyl pyrrolidone.The results showed that the linear dynamic range of 17 drugs was 1-500 ng/L, the recovery was 43%-105%, the matrix effect was more than 67%, the limit of quantitative detection was 1-2 ng/L, and the detection time of each sample was 2.98s. It can be seen that the developed magnetic solid-phase extraction (MSPE) method is a good solution to the problem of complicated pre-treatment and analytical cost in the detection of drugs in wastewater. The developed magnetic material and acoustic excitation coupled mass spectrometry analysis method can realize the low-cost, efficient enrichment and fast analysis of different kinds of drug molecules in urban sewage.

In this paper we address the approximation of the coupling problem for the wave equation and Maxwell's equations of electromagnetism in the time domain in terms of the electric field, by means of a nodal linear finite-element discretization in space, combined with a classical'explicit finite-difference scheme for the time discretization. Our study applies to the particular case where the dielectric permittivity has a constant value outside a sub-domain, whose closure does not intersect the boundary of the domain where the problem is defined. Inside this sub-domain Maxwell's equations hold. Outside this sub-domain the wave equation holds, which may correspond to the Maxwell's equations with a constant permittivity under certain conditions. We consider as a model the case of first order absorbing boundary conditions. Optimal error estimates that hold in natural norms under reasonable assumptions are given, among which lies a typical CFL condition for hyperbolic equations.

The lactic acid bacteria Streptococcus thermophilus and Lactobacillus helveticus are commonly used as starter cultures in dairy product production. This study aimed to investigate the characteristics of fermented milk using different ratios of these strains and analyze the changes in volatile compounds during fermentation and storage. The 10:1 ratio of Streptococcus thermophilus CICC 6063 to Lactobacillus helveticus CICC 6064 showed optimal fermentation time (4.2 h), viable cell count (9.64 log10 colony-forming units/mL), and sensory evaluation score (79.1 points). In total, 56 volatile compounds were identified and quantified by solid-phase microextraction and gas chromatography–mass spectrometry (SPME-GC-MS), including aldehydes, ketones, acids, alcohols, esters, and others. Among these, acetaldehyde, 2,3-butanedione, 2,3-pentanedione, 2-heptanone, acetoin, and 1-heptanol had the highest odor activity values and contributed to the characteristic flavor of fermented milk. The concentrations and types of key flavor compounds reached their peak at the end of fermentation. Throughout the fermentation and storage process, the levels of 2,3-pentanedione and acetoin exhibited synergistic dynamics. These findings enhance our understanding of the chemical and molecular characteristics of milk fermented with Streptococcus thermophilus and Lactobacillus helveticus, providing a basis for improving the flavor and odor of dairy products during fermentation and storage.

Ultra-low radioactive titanium alloy is a promising material for the manufacture of low-background detectors, which are being developed for experiments in astroparticle physics and neutrino astrophysics. Structural titanium is manufactured on an industrial scale from titanium-sponge. The ultra-low-background titanium-sponge can be produced on an industrial scale with a contamination level of less than 1 mBq/kg of uranium and thorium isotopes. The pathways of contaminants during the industrial production of structural titanium have been analyzed. The measurements have been carried out using two methods: inductively coupled plasma spectroscopy (ICP-MS) and gamma-spectroscopy using high-purity germanium detectors (HPGe). It has been shown that the level of contamination with radioactive impurities does not increase during remelting of titanium-sponge and mechanical processing. We examined titanium-alloys samples obtained at different stages of titanium production, namely, an electrode compaction, a vacuum arc remelting with a consumable electrode (VAR), and a cold rolling of titanium-sheets. It has been found out that all studied samples will be a source of uranium and thorium contamination of the final titanium-alloys. It has been established that the only product allowed obtaining ultra-low-background titanium was the VT1-00 which is manufactured without master alloys addition..

Objetives: Adequate donor-recipient matching is necessary to achieve the best renal function after transplantation. The nephron load received from the donor, which can be reflected in variables such as age, sex and body mass index, may influence the evolution of the graft. Our objetive was develop a combined score according to the donor-recipient pairing in age, sex and body mass index, and assess its influence on the evolution of the renal graft. Materials and methods: Transplant patients between 2013 and 2020 who had at least 1 year of post-transplant follow-up. A ranking of 0 to 2 points was awarded according to the match between donor and recipient for sex, age and body mass index individually, with higher rank to greater mismatch. Subsequently, a Score with value of 0 to 6 points was created with the combined ranking of the indivudual variables, analyzing its influence on the evolution of the graft by multivariate linear regression. Results: 280 patients followed for 4.3 years of median. Worse renal function was observed at the end of follow-up as the range of each variable increased separately, and the Score created, with a worsening of renal function as the combined Score increased in the multivariate analysis: Coefficient B= -2.4 ml/min, p=0.018. Conclusions: An adequate match between donor and recipient in age, sex and body mass index using this combined Score can help achieve better kidney function after transplantation.

Nurses and paramedics play a pivotal role when Mass Casualty Incidents (MCI) occur, yet they often feel unprepared for such events. Implementation strategies for training activities, including Virtual Reality (VR) and Augmented Reality (AR) simulations, offer realistic and immersive learning experiences, enhancing skills and competencies for nursing students. The aim of this work was to investigate the adopted tools in studies on VR&amp;AR simulations for training nursing and paramedic students in managing MCI. A scoping review was performed following the PRISMA-ScR statement, and the search strategy was conducted through five electronic databases from December 2022 to March 2023. Of 162 records identified, 27 full-text were screened and, six studies were included in this review. These studies involved students who were assigned to different training methods, including immersive VR simulation, written instruction, and traditional lecture. VR&amp;AR and immersive simulation generally show promising evidences in enhancing practical skills and knowledge in MCI management. VR&amp;AR showed to be promising in disaster education and preparedness training, offering different levels of immersiveness and engagement, encouraging active and experential learning. Further research is needed to determine their long-term effectiveness. The choice of training method should consider program goals, target population, and available resources.

Proteomics in respiratory allergic diseases has such a battery of techniques and programs that one would almost think that there is nothing impossible to find, invent or mold. All these resources that we document here, are involved in solving problems in allergic diseases, both diagnostic, prognostic, treatment and immunotherapy development. The main perspectives, according to this version, are in three strands and / or lockout immunological system: 1) In blocking the diapedesis of cells involved, 2) modifications and blocking of paratopes and epitopes being understood by modifications to antibodies, antagonism or blocking them and 3) blocking FcεR1 receptors to prevent specific IgEs from sticking to mast cells and basophils. These tools and targets in the allergic landscape are, in our view, the prospects in the field.

To compare concentrations of endogenous N-acylethanolamines (NAEs) lipid mediators pal-mitoylethanolamide (PEA), oleoylethanolamide (OEA), and anandamide (AEA) in fresh, decon-taminated, cryopreserved and freeze-dried amniotic membrane (AM) allografts. Thereby deter-mining whether AM's analgesic and anti-inflammatory efficiency related to NAEs persists during storage. The concentrations of NAEs were measured using ultra-high-performance liquid chro-matography-tandem mass spectrometry. Indirect fluorescent immunohistochemistry was used to detect the PEA PPARα receptor. The concentrations of PEA, OEA, and AEA were significantly higher after decontamination. A significant decrease was found in cryopreserved AM compared to decontaminated tissue for PEA but not for OEA and AEA. However, significantly higher val-ues for all NAEs were detected in cryopreserved samples compared to fresh tissue before decon-tamination. The freeze-dried AM had similar values to decontaminated AM with no statistically significant difference. The nuclear staining of PPARα receptor was clearly visible in all specimens. The stability of NAEs in AM after cryopreservation was demonstrated under tissue bank storage conditions. However, a significant decrease, but still higher concentration of PEA compared to fresh not decontaminated tissue was found in cryopreserved, but not frieze-dried AM. Results in-dicate that NAEs persist during storage in levels sufficient for the analgesic and anti-inflammatory effects of AM allografts.

The evolution of even and odd Schrödinger cat states of the inverted oscillator is obtained in the center-of-mass tomographic probability description of the two-mode oscillator.The notion of entangled probability distribution is reviewed. Evolution equations describing the time-dependence of probability distributions identified with quantum system states are discussed.The connection with the Schrödinger equation and the von Neumann equation is clarified.

Unmetamorphosed carbonaceous chondrites provide important information concerning the formation and evolution of organic matter, such as amino acids. However, terrestrial contamination remains a valid concern when investigating the organic inventory of meteorites that have fallen to Earth. Accordingly, JAXA’s Hayabusa2 and NASA’s OSIRIS-REx have been launched with the task of returning uncontaminated C-type asteroid material to Earth. The successful Hayabusa2 mission has a very limited sample size (5.4 g). Therefore, many conventional compound specific techniques will struggle to detect amino acids above detection limit with available sample amounts (~several mg to 10’s of mg) being much smaller than those typically used. Here a novel method utilizing ultrahigh performance liquid chromatography-Orbitrap-mass spectrometry is validated and applied to very small meteorite samples, thus providing an approach that can overcome the small sample size constraints of sample return missions. The method is highly sensitive, enabling the detection of amino acids in the carbonaceous chondrites Murchison (2.28 mg) and Orgueil (2.30 mg). Furthermore, quantitation was possible for many of the detected amino acids in Murchison and Orgueil. Using the data presented here, both the amino acid reservoirs of Murchison and Orgueil and the potential application of this method to sample return samples are discussed.

The 2-oxoglutarate dehydrogenase complex (OGDHc) is a key enzyme in the TCA cycle and represents one of the major regulators of mitochondrial metabolism through NADH and reactive oxygen species levels. The OGDHc impacts cell metabolic and cell signaling pathways through the coupling of 2-oxoglutarate metabolism to gene transcription related to tumor cell proliferation and aging. DHTKD1 is a gene encoding 2-oxoadipate dehydrogenase (E1a), which functions in the L-lysine degradation pathway. The potentially damaging variants in DHTKD1 have been associated to the (neuro) pathogenesis of several diseases. Evidence was obtained for the formation of a hybrid complex between the OGDHc and E1a, suggesting a potential cross talk between the two metabolic pathways and raising fundamental questions about their assembly. Here we reviewed the recent findings and advances in understanding of protein-protein interactions in OGDHc and 2-oxoadipate dehydrogenase complex (OADHc), an understanding that will create a scaffold to help design approaches to mitigate the effects of diseases associated with dysfunction of the TCA cycle or lysine degradation. A combination of biochemical, biophysical and structural approaches such as chemical cross-linking MS and cryo-EM appears particularly promising to provide vital information for the assembly of 2-oxo acid dehydrogenase complexes, their function and regulation.

Geomagnetic induced current (GIC) is a ground end manifestation associated with the space weather perturbations that should be greatly taken into account by the society. Although the GICs implication to the power system is not regular, it can cause large scale of system failure. In equatorial, the power system is considered safe since the most intense of geomagnetic storm happened in high latitude. However, the internal damage due to GICs which finally led to the South African power system failure has totally changed the normal perception. Therefore, a preliminary investigation on the GICs activity in equatorial region is performed to understand the space weather impact to the power system. Time derivative of the horizontal magnetic field component (dB/dt) is done to indicate the GICs activity value based on Faraday’s law. All the reported power failures are compiled to produce the threshold value of dB/dt, which possibly cause the harmful effect to the system. Then, dB/dt analysis is extended to show the pattern of GICs activity in function of magnetic latitude and local time. The results reveal that power network in equatorial region has possibly suffered by GIC. Plus, high number of intense GIC activity in this region occurred during dayside.

This study provides designs for a low-cost, easily replicable open source lab-grade digital scale that can be used as a precision balance. The design is such that it can be manufactured for use in most labs throughout the world with open source RepRap-class material extrusion-based 3-D printers for the mechanical components and readily available open source electronics including the Arduino Nano. Several versions of the design were fabricated and tested for precision and accuracy for a range of load cells. The results showed the open source scale was found to be repeatable within 0.1g with multiple load cells, with even better precision (0.01g) depending on load cell range and style. The scale tracks linearly with proprietary lab-grade scales, meeting the performance specified in the load cell data sheets, indicating that it is accurate across the range of the load cell installed. The smallest loadcell tested(100g) offers precision on the order of a commercial digital mass balance. The scale can be produced at significant cost savings compared to scales of comparable range and precision when serial capability is present. The cost savings increase significantly as the range of the scale increases and are particularly well-suited for resource-constrained medical and scientific facilities.

The research is devoted to the acute problem of cinema influence on the young audience. With the continuous development of mass media, cinema is still one of the most popular leisure activities, remaining an influential tool on the picture of the world, values, stereotypes, the behavior of viewers, etc. The paper studies the effects of the cinema on young viewers in relation to their ideas about the elderly. Using a psychosemantic technique that includes 25 scales designed specifically to identify the content of representation of older people, respondents evaluated their various characteristics before and after watching the film. It should be noted that after watching a film about the elderly, the respondents changed their representations of motivational and regulatory, cognitive and emotional characteristics of the older people. However, the changes were not similar in different groups of young people: students seemed to have more negative representation, graduate students’ assessment, on the contrary, changed for a better one. The discovered opposite effects of the cinema influence can be explained by a number of reasons starting from age, personal experience of the respondents, the formation of ideas to the special features of the film itself. In this regard, the contribution of individual factors to the efficiency of the cinema impact and the prediction of its specific effects requires further study.

Background Telomere shortening is related to aging and unfavourable health outcomes. Obesity and metabolic diseases are important factors for accelerating aging. This study aimed to find out the association between obesity, metabolic disease, and telomere length in metabolically healthy adults. Methods 237 adults were enrolled with written consents at a health promotion centre of a tertiary hospital from February 2014 to March 2015. After excluding 99 subjects who met the exclusion criterion, a total of 130 metabolically healthy subjects were selected for final analysis. The subjects were divided into quartile groups according to the telomere lengths of their oral mucosal cells. Results The subjects consisted of 66 (50.8%) males with a mean age of 58.59 years. The body mass index (BMI, kg/m2) increased significantly along with the quartile groups (Q1, 23.00; Q2, 23.96; Q3, 23.70; Q4, 25.20; P-for trend=0.008). Waist circumference (WC, P-for trend=0.022), waist-to-hip ratio (WHR, P-for trend=0.005), and waist-to-height ratio (WHtR, P=0.001) also increased along with the quartile groups. Obesity prevalence (BMI ≥25 kg/m2), abdominal obesity (WC ≥90 cm for men, ≥85 cm for women), WHR 〉1.0 for men or 〉0.85 for women, and WHtR ≥0.5 increased significantly as the telomere length increased (P-for trend <0.05). After adjusting for covariates, the ORs for each obesity markers increased as the telomere length increased (P-for trend <0.05); and the ORs of WHtR were especially meaningful (Q1, 1.00; Q2, 2.53; Q3, 2.97; Q4, 7.81; P-for trend = 0.001). There were no significant trends for metabolic syndrome and its components along with the prevalence of fatty liver disease. Conclusion Obesity markers and telomere length had significant positive correlation despite the established theory. The obesity paradox may exist in metabolically healthy adults with regard to telomere length, However, further studies with larger sample sizes for the association between obesity and telomere length are needed.

We explore the field equations in a 4-d complex space-time, in the same way, that general relativity does for our usual 4-d real space-time, forming this way, a new "general relativity" in C⁴ space-time, free of sources. Afterwards, by embedding our usual 4-d real space-time in C⁴ space-time, we describe geometrically the energy-momentum tensor T_μν as the lost geometric information of this embedding. We further give possible explanation of dark eld and dark energy.

In China's mountainous coastal terrain, the storm badly damaged low-rise buildings. At present, it is not clear how the relative position of buildings and mountains affects the surface of a low-rise building’s fluctuating coefficient. The study compared these results with the wind pressure distribution without the surrounding environment. The primary objective of this study is to examine the fluctuating coefficient variation rule based on the spacing between hillsides and buildings under 0° wind angle. Additionally, the study analyzes the fluctuating wind pressure coefficient across wind angles between 0°~90°. The distribution of wind pressure in different common hillside landforms was examined through a wind tunnel experiment, which also compared with the distribution in an open environment. The study examined the fluctuating coefficient as the distance between the building and the hillside changed, specifically for wind blowing at a 0° angle. Next, an analysis is conducted on the changing pattern of the fluctuating coefficient for low-rise buildings ranging from a wind angle of 0° to 90°. Simultaneously, the investigation examined the power spectrum and wind pressure’s probability distribution, while considering the proximity of the building to an adjacent hill. The findings indicated that the changing wind pressure factor on the surface of the structure differed based on the relative location of the hillside and the building. The roof's wind pressure coefficient fluctuated and gradually increased until it reached its peak, unaffected by the surroundings. The low-frequency energy decreased in windward eaves, while the high-frequency energy progressively rose as the distance between the hillside and the building increased. The wind pressure on the leeward side exhibited Gaussian characteristics in its probability distribution.

Smart farm is a technology that greatly helps improve the productivity and quality of crops and is being actively introduced into indoor environments such as green houses. However, it has not yet been distributed to field-grown crops. The main reason is that, unlike indoor environments, it is very difficult to collect sensor data for monitoring the growth environment of crops in open fields where weather conditions change significantly and power supply is difficult. Additionally, because various sensors are used, the data formats of the devices are different, making it difficult to process. This paper presents a field crop growth environment monitoring and big data analysis system. The proposed system first solves power supply and data communication problems using solar power generation and LPWA technology. Additionally, based on the oneM2M architecture, data from various sensors is transmitted to the server using standardized technology. The transmitted data is stored and managed on the server as big data, and can be used to predict the production and quality of field-grown crops and take appropriate measures. The proposed system is expected to create an environment optimized for the growth of field crops and help prevent and manage diseases.

We offered the circuit of a discrete analog filter (DAF) low frequencies of second-order on switchable capacitors, which differs from the known ones in that three capacitors with one terminal are connected to a common bus, and the frequency of the DAF pole depends not only on the ratio of the capacitances of the frequency-setting capacitors, but also on the ratio of resistances two additional resistors in the feedback. This allows at constant values ​​of the capacitances and a fixed switching frequency of electronic switches, control the pole frequency by changing the resistance ratio of additional resistors. Computer simulation of the developed circuit was performed in the Micro-Cap environment. It has been established that the DAF has a transmission coefficient close to minus one at very low frequencies and a transmission coefficient close to zero at higher frequencies.

For many years, energy monitoring at the most disaggregate level has been mainly sought through the idea of Non-Intrusive Load Monitoring (NILM). Nevertheless, a practical application of this concept in the residential sector should address the underlying concerns raised by the technical specifications of case studies. From one side, such an operation must handle common matters related to the essence of any NILM system. Although this aspect has been thoroughly investigated by basic research, it is limited to the properties of public datasets. On the other side, it must deal with specific concerns corresponding to uncommon situations. These circumstances impose further restrictions on existent NILM schemes, however, they have been overlooked due to the lack of pertinent databases to scrutinize. Accordingly, this paper presents applied research on a potential solution to NILM for Quebec residences. It carries out a relevant investigation into the multi-faceted nature of this problem in order to reveal barriers to feasible implementations in the context of Quebec. This work commences with a concise discussion about the NILM idea to highlight its essential requirements for a fruitful practice. Afterward, it provides a comparative statistical analysis to represent the specificity and potential challenges of the case study in accordance with NILM necessities. For this purpose, the examination exploits data from real-world measurement systems in the same and European regions. Subsequently, this study focuses on a load identification exercise by proposing a combinatory approach that utilizes the promise of sub-meter smart technologies to integrate the intrusive aspect of load monitoring with the non-intrusive one. The former is aimed at extracting overall heating demand from the aggregate one by a supervised procedure based on Deep Learning (DL) models while the latter is designed for disaggregating the residual load through an unsupervised process on the basis of clustering techniques. The results demonstrate that geographically-dependent cases create electricity consumption scenarios under which existing NILM methods can be questioned. From a realistic standpoint, this research elaborates on critical remarks to realize viable NILM systems, particularly, in Quebec houses.

Low-sodium salt substitute (LSSS) has the potential in regulating sodium and potassium intake and has been available in China market for years. However, its real-world use and impact to sodium\potassium intake is unclear. Baseline data of 4000 adult participants who participated in three similar-designed randomized controlled trails were pooled together for this study. Self-reported awareness and use of LSSS were collected using the uniform questionnaire, and the 24-h urinary sodium and potassium excretion was used to estimate their dietary intake. Mixed-effects models were developed to assess the relationship between LSSS and 24-h urinary sodium and potassium excretion. 32.0% of the participants reported awareness of LSSS and 11.7% reported its current use. After adjusting location, sex, age, and education, compared with the group of participants unaware of LSSS, participants who were aware but not using LSSS and those who were using LSSS had a lower 24-h urinary sodium excretion by –356.1(95% CI: –503.9, –205.9) mg/d and –490.6(95% CI: –679.2, –293.7), respectively (p&lt;0.001). No significant difference was found for 24-h urinary potassium excretion and sodium-to-potassium ratio among the three groups (p&gt;0.05). In conclusion, although associated with lower sodium intake, the awareness and real-world use of LSSS are still very low in China.

An inter- and transdisciplinary concept has been developed, focusing on the scaling of industrial circular construction using innovative compacted mineral mixtures (CMM) derived from various soil types (sand, silt, clay) and recycled mineral waste. The concept aims to accelerate the systemic transformation of the construction industry towards carbon neutrality by promoting the large-scale adoption and automation of CMM-based construction materials, which incorporate natural mineral components and recycled aggregates or industrial by-products. In close collaboration with international and domestic stakeholders in the construction sector, the concept explores the integration of various CMM-based construction methods for producing wall elements in conventional building construction. Leveraging a digital urban mining platform, the concept aims to standardize the production process and enable mass-scale production. The ultimate goal is to fully harness the potential of automated CMM-based wall elements as a fast, competitive, emission-free, and recyclable alternative to traditional masonry and concrete construction techniques. To achieve this objective, the concept draws upon the latest advances in soil mechanics, rheology, and automation and incorporates open-source digital platform technologies to enhance data accessibility, processing, and knowledge acquisition. This will bolster confidence in CMM-based technologies and facilitate their widespread adoption. The extraordinary transfer potential of this approach necessitates both basic and applied research. As such, the proposed transformative, inter- and transdisciplinary concept will be conducted and synthesized using a comprehensive, holistic, and transfer-oriented methodology.

Urinary incontinence (UI) is a common geriatric syndrome affecting bladder health and is especially prevalent in nursing homes (NHs). The aim of the study was to determine the prevalence of UI and its associated factors in 5 Spanish NHs. UI (measured with Minimum Data Set 3.0.), sociodemographic and health-related variables were collected. Chi- square (or Fisher’s) or Student’s t-test (or Mann Whitney U) for bivariate analysis were used, with Prevalence Ratio (PR) as an association measure. The prevalence of UI was 66.1% (CI:95%, 53.6–77.2) and was significantly associated with frailty (PR 1.84; 95%CI 0.96–3.53), faecal incontinence (FI) (PR 1.65; 95%CI 1.02–2.65), anxiety (PR 1.64; 95%CI 1.01–2.66), physical performance (PR 1.77; 95%CI 1.00–3.11) and cognitive state (PR 1.95; 95%CI 1.05–3.60). Statistically significant differences between incontinent-continent groups were found for activities of daily living (ADL) limitations, mobility, quality of life, sedentary behaviour (SB) and handgrip strength. It can be concluded that 2/3 of the residents experienced UI, and its significant associated factors were mainly physical (SB, frailty, physical performance, ADL limitations, mobility, FI and handgrip strength) followed by psycho-cognitive factors (cognition, anxiety and quality of life).

Today, more disciplines are intercepting each other, giving rise to “cross-disciplinary” research. Technological advancements in material science and device structure and production have paved the way towards development of new classes of multi-purpose sensory devices. Organic phototransistors (OPTs) are photo-activated sensors based on organic field-effect transistors that convert incident light signals into electrical signals. The organic semiconductor (OSC) layer and three-electrode structure of an OPT offer great advantages for light detection compared to conventional photodetectors and photodiodes, due to their signal amplification and noise reduction characteristics. Solution processing of the active layer enables mass production of OPT devices at significantly reduced cost. The chemical structure of OSCs can be modified accordingly to fulfil detection at various wavelengths for different purposes. Organic phototransistors have attracted substantial interest in a variety of fields, namely biomedical, medical diagnostics, healthcare, energy, security, and environmental monitoring. Lightweight and mechanically flexible and wearable OPTs are suitable alternatives not only at clinical levels but also for point-of-care and home-assisted usage. In this review, we aim to explain different types, working mechanism and figures of merit of organic phototransistors and highlight the recent advances from the literature on development and implementation of OPTs for a broad range of research and real-life applications.

Insulin-like growth factor binding proteins (IGFBPs) are critical modulators of the metabolism. In adults, IGFBPs are associated with obesity and insulin resistance but the association of IGFBPs with metabolic homeostasis in children and adolescents is not fully characterized. In this study we investigated the association of plasma IGFBPs (IGFBP-1, 3 and 7) with weight status, central adiposity and cardiovascular disease markers Hs-CRP and Ox-LDL. A total of 420 adolescents (age 11-14 years) were randomly recruited from public middle schools in Kuwait. IGFBPs were measured using bead-based multiplexing while Hs-CRP and Ox-LDL were measured using ELISA. IGFBP-1 levels were significantly lower in obese and overweight participants compared to normal weight children. Only IGFBP-1 was negatively associated with waist circumference to height (WC/Ht) ratio. IGFBP-1 was negatively correlated with Hs-CRP while IGFBP-3 and IGFBP-7 were negatively correlated with Ox-LDL. These data demonstrate a robust negative association of IGFBP-1, but not IGFBP-3 or -7, with overweight and obesity, and the inflammation marker Hs-CRP. Central adiposity (WC/Ht ratio) was a stronger predictor of IGFBP-1 than BMI-for-age z-score. IGFBP-1 could thus be used as a sensitive predictive diagnostic tool for obesity and its subsequent effects in screening and monitoring of obesity-related metabolic complications in adolescents.

The epidemic transmission of Zika virus (ZIKV) in Brazil has been identified as a cause of microcephaly and other neurological malformations in babies of ZIKV-infected women. This study provides a descriptive analysis, since the onset of symptoms to the delivery, of a cohort who were registered as having ZIKV infection in pregnancy, from November 2015 to December 2016. Suspected cases were registered at a referral center for infectious and tropical diseases in Manaus, in the Brazilian Amazonian region. A total of 834 women with suspected ZIKV in pregnancy were included, of whom 91.4% had confirmed pregnancy. Reverse-transcriptase polymerase chain reaction (RT-PCR) confirmed ZIKV infection in 42.2% of the cohort. In 35.2% of the cohort, ZIKV was the sole infection identified. Severe adverse pregnancy outcomes (abortion, stillbirth, or microcephaly) were observed in both RT-PCR ZIKV-positive (4.96%) and ZIKV-negative (2.15%) cases. Women with suspected ZIKV infection were much more likely to have adverse pregnancy outcomes if they were symptomatic during the first trimester of pregnancy (odds ratio 10.5; 95% confidence interval 4.0–27.0; p<0.001). Among pregnant women with suspected ZIKV infection, the occurrence of symptoms in the first trimester is associated with an especially high risk of severe adverse pregnancy outcomes.

The slate aggregate has long been perceived as a substandard, low quality waste material with its physical and chemical properties not being competitive with those of the primary aggregates. It is assumed that the slate aggregate particles are not strong, that is not durable and will not compact. This research aims to address those claims and review the available literature on the performance of the slate aggregate. The review inaugurates by analysing the physical, chemical and mechanical properties of slate, before expanding into a literature review of laboratory testing’s on the effect of moisture content on density, compaction and layer thickness of slate aggregate.The paper reviews case studies of construction projects in North Wales, where the slate aggregate has been used for general fill and road building for many years. Some of the case studies include the A55 coastal road and duelling of the A5 in Anglesey (WRAP, 2004), where slate aggregate was successfully used as sub-base. The paper also investigates why many civil engineers are reluctant to use the slate aggregate and regard the material as sub-standard, flaky aggregate. The research paper reviews the potential usages and various products the slate aggregate is suitable for and satisfies the requested standards. The final topic reviewed is the cost of transporting slate aggregate compared with the cost of transport for primary aggregate and the introduction of the Primary Aggregates Tax (Parliament of the United Kingdom, 2011). The last topic includes a critical analyses of the claims that the slate aggregate a commercially viable construction material despite its remote location (Woodward et al, 2004). The transportation cost and the supply chain complexities must be evaluated prior to considering the long-term sustainability of the product (Radanliev et al^1-6, 2014, 2015, 2016).

The new observations, including the fastest star, the circular velocity curve of the Milky Way and the fast galaxy bar, should imply that the mass of the center of the Milky Way is almost 10¹¹ times the mass of the Sun.

Candidiasis is one of the global public health problems. In fluconazole resistant Candida spp. (FRCS), mutations in ergosterol biosynthesis gene 11 (ERG 11) have been commonly found. This study aimed to determine the profile of FRCS isolates and to detect mutations in part of ERG 11 gene in fluconazole resistant Candida albicans (FRCA) isolates. Study was conducted on 150 isolates of FRCS obtained from patients admitted in a tertiary care hospital, South India from September 2019 to December 2021. Candida spp. was identified by MALDI-TOF MS and fluconazole resistance was detected by VITEK 2 system. Following which a part of the ERG 11 gene of the FRCA isolates were amplified, purified, sequenced and a phylogenetic tree was constructed. Out of the 150 FRCS, the most common FRCS was C. auris followed by C. glabrata, C. krusei, C. parapsilosis, C. albicans, C. tropicalis and C. guilliermondii. Sequencing of amplicons detected a single missense mutation and 44 silent mutations. We opined that fluconazole resistance in FRCA isolates may be due to mecha-nisms other than the studied one in our region. Phylogenetic analysis of amplified sequences of 12 FRCA isolates observed three clusters and all 12 sequences showed relatedness to Malaysian 2019 isolates.

The aim of this study is to propose and validate the state space mode decomposition technique for precise mode separation of non-classical damping systems and closely distributed modal systems. To assess the reliability and applicability of this technique, a 40-story building with a tuned mass damper is investigated, and acceleration responses measured by the building's health monitoring system are used for the verification of the technique. The mode separation results reveal that the separated modal power spectrum becomes distorted at neighboring natural frequency ranges when the performance index only considers the concentration of power spectral energy at the target natural frequency. However, by introducing an augmented performance index that includes a constraint condition to account for distortion, more accurate mode decomposition can be achieved.

In this study, we focus on the effects of fuel bed representation and fire heat and smoke distribution in a coupled fire-atmosphere simulation platform for two landscape-scale fires: the 2018 Camp Fire and the 2021 Caldor Fire. The fuel bed representation in the coupled fire-atmosphere simulation platform WRF-Fire currently includes only surface fuels. Thus, we enhance the model by adding canopy fuel characteristics and heat release, for which a method to calculate the heat generated from canopy fuel consumption is developed and implemented in WRF-Fire. Furthermore, the current WRF-Fire heat and smoke distribution in the atmosphere is replaced with a heat-conserving Truncated Gaussian (TG) function and its effects are evaluated. The simulated fire perimeters of case studies are validated against semi-continuous, high-resolution fire perimeters derived from NEXRAD radar observations. Furthermore, simulated plumes of the two fire cases are compared to NEXRAD radar reflectivity observations followed by buoyancy analysis using simulated temperature and vertical velocity fields. The results show that while the improved fuel bed and the TG heat release scheme have small effects on the simulated fire perimeters of the wind-driven Camp Fire, they affect the propagation direction of the plume-driven Caldor Fire, leading to better-matching fire perimeters with the observations. However, the improved fuel bed representation together with the TG heat smoke release scheme leads to more realistic plume structure in comparison to the observations in both fires. The buoyancy analysis also depicts more realistic fire-induced temperature anomalies and atmospheric circulation when the fuel bed is improved.

Based on four major cosmological and astrophysical coincidences, it seems possible to develop a new model of Hubble-Hawking Universe having light speed expansion. Considering the analysis of 740 super novae data, it is possible to consider a constant rate of cosmic expansion. As there is no physical reasoning for the observed speed of light and all the cosmological observations are completely based on speed of light-by considering ‘light speed expansion’ as a characteristic nature of the universe, big bang, inflation, dark energy, quintessence and lambda term like ideal and unidentified concepts can be reviewed and relinquished at fundamental level and a practical model of expanding universe can be developed with ease and clarity. In this context, we would like to emphasize the point that, traditional definition of cosmic red shift is absolutely wrong. In terms of energy of photon, true cosmic red shift must be defined as - ratio of loss of energy in photon to the energy of photon at galaxy. We encourage the reader to see Figure 1 and Table 1 pertaining to light travel distances prepared with $\left(\frac{z}{1+z}\right)\left(\frac{c}{H_0}\right)\cong z_{new}\left(\frac{c}{H_0}\right)$. For data comparison, readers are encouraged to visit https://cosmocalc.icrar.org/ and http://www.atlasoftheuniverse.com/cosmodis.c. It may be noted that, considering 200 million solar masses as a cut off for ordinary gravity, dark matter can be considered as an effect of power law based super gravity of galactic baryonic mass. It is well believed that, Hawking’s findings about black holes are the most important contributions to physics in recent decades. Hence, we appeal the science community to recommend our Hubble-Hawking model for further research and study.

The behavior of convective boundary conditions is studied to delineate their role in heat and mass relegation in the presence of radiation, chemical reaction, and hydromagnetic forces in three-dimensional Powell-Eyring nanofluids. Implications concerning non-Fourier’s heat flux and non-Fick’s mass flux with respect to temperature nanoparticle concentration were examined to discuss the graphical attributes of the principal parameters. An efficient optimal homotopy analysis method is used to solve the transformed partial differential equations. Tables and graphs are physically interpreted for significant parameters

Peat is the main type of peloid used in Polish cosmetic/healing spa facilities. Depending on treatment and origin, peat waste can be contaminated microbiologically, and as result, it has to be incinerated in medical waste incineration plants without energy recovery (local law). Such a situation leads to peat waste management costs increase. Therefore in this work, we checked the possibility of peat waste upcycling to carbonized solid fuel (CSF) using torrefaction. Torrefaction is a thermal treatment process that removes microbiological contamination and improves the fuel properties of peat waste. In work torrefaction conditions (temperature and time) on CSF quality were tested. Parallelly, peat decomposition kinetics using TGA, and torrefaction kinetics with lifetime prediction using macro-TGA were determined. Furthermore, torrefaction theoretical mass and energy balance were determined. The results of the tested peat were compared with reference material (wood), and as result, obtained data can be used to adjust currently used wood torrefaction technologies for peat torrefaction. The results show that torrefaction can improve the high heating value of peat waste from 19.0 MJ x kg-1 to 21.3 MJ x kg-1, peat main decomposition takes place at 200-550 °C following second reaction order (n=2), with an activation energy of 33.34 kJ x mol-1 and pre-exponential factor of 4.40 x 10-1 s-1. Moreover, DSC analysis revealed that peat torrefaction required slightly more energy than wood torrefaction, and macro TGA showed that peat torrefaction has lower torrefaction constant reaction rates (k) than wood 1.05 x 10-5 - 3.15 x 10-5 vs 1.43 x 10-5 - 7.25 x 10-5 s-1.

The textbook analysis of vacuum energy density (VED) in flat spacetime follows from Pauli’s lectures of 1951, in which quantum vacuum is modeled as a reservoir of free harmonic oscillators. In his lectures, Pauli shows that deriving a nearly vanishing VED is contingent upon fulfilling three corollary conditions called polynomial-in-mass-constraints. The goal of this work is to evaluate Pauli’s constraints against the Standard Model parameters and the Higgs mechanism of spontaneous symmetry breaking.

Fundamental principles of classical (Newtonian) physics are employed to probe the cosmological lambda Λ; it yields the values ρ_vac = 2.61 x 10^-39 g cm^-3 and Λ = 4.87 x 10^-66 cm^-2. It is revealed that Λ is a fundamental physical constant defined by vacuum density-light speed ρ_vacc² correlation. However, the constant accelerates along the groups and periods of a universal spatial periodicity equivalent to the chemical periodicity. Previous results are cited to show that chemical elements are quantum harmonic (periodic) oscillators QHOs and their waveform oscillations exclusively define the vacuum field. The cosmological periodic unit CPU is introduced, it relies on the cosmological principle to argue that a relative physical quantity evaluated for the QHO applies to constituents of corresponding cosmological spatial quanta. Compelling evidences, backed with relevant data and quantitative expressions, are then presented to argue that: there was never a big bang, it is a Linde-universe sans “chaotic”; nature posts no singularity; mass does not curve spacetime, neither does metric space curvature trace directly to gravitation nor particle creation, gravity is classical, not quantum; reality is quadri-phasic not mono-phasic with a clear distinction between the atomic waveform defined with absolute atomic mass and condensed matter defined with relative atomic mass; every chemical element exists in three particle-generations thus, dark matter is invisible form (conjugate) of the visible element, its waveform manifests dark energy, it is not implicated in metric space expansion; Planck scale does not exist, radioactivity constrains fundamental length to atomic radius of the heaviest element.

Fibroblast growth factor 14 (FGF14) is a member of the intracellular FGFs, a group of proteins with roles in neuronal ion channel regulation and synaptic transmission. We have previously demonstrated that a male Fgf14-/- mouse model recapitulates salient endophenotypes of synaptic dysfunction and behaviors associated with schizophrenia (SZ). As the underlying etiology of SZ and its sex-specific onset remain elusive, the Fgf14-/- model provides a valuable tool to interrogate pathways that might be related to the disease mechanism. Here, we performed label free quantitative proteomics and bioinformatics to identify enriched pathways at the proteome level in the male and female hippocampi from Fgf14+/+ and Fgf14-/- mice. We discovered that many differentially expressed proteins in Fgf14-/- animals are associated with SZ. In addition, measured changes in the proteome and signaling pathways were predominantly sex-specific with the male Fgf14-/- being distinctly enriched for pathways associated with neuropsychiatric disorders and addiction and the female exhibiting modest changes. In the male Fgf14-/- mouse the major protein changes that could in part explain the previously described neurotransmission and behavioral phenotype of this model were loss of ALDH1A1 and PRKAR2B. ALDH1A1 has been shown to mediate an alternative pathway for GABA synthesis, while PRKAR2B is essential for dopamine 2 receptor signaling, which is the basis of current antipsychotics. Collectively, our results provide new insights in the role of FGF14 and support the use of the Fgf14-/- mouse as a useful preclinical model of SZ for generating hypothesis on the disease mechanism, sex-specific manifestation and therapy.

The current study applied a new approach for the interpolation and regionalization of observed precipitation series to a smaller spatial scale (0.125° by 0.125° grid) across the Upper Indus Basin (UIB), with appropriate adjustments for the orographic effect and changes in glacier storage. The approach is evaluated and validated through reverse hydrology, guided by observed flows and available knowledge base. More specifically, the generated corrected precipitation data is validated by means of SWAT-modelled responses of the observed flows to the different input precipitation series (original and corrected ones). The results show that the SWAT- simulated flows using the corrected, regionalized precipitation series as input are much more in line with the observed flows than those using the uncorrected observed precipitation input for which significant underestimations are obtained.

Gas-water relative permeability curve is the foundation of gas reservoir dynamic analysis and numerical simulation. It is generally obtained through gas displacing water experiment. Referring to the existing national standards, gas-water relative permeability test is carried out for low-permeability and tight sandstone. The flow is discontinuous and the curve smoothness is poor, which affects the application of gas-water relative permeability curve. Based on the comparative analysis of a large number of mercury injection and NMR experimental results of low-permeability and tight sandstone, a method to characterize the throat radius distribution of low-permeability tight sandstone based on NMR T2 spectrum is explored. Combined with high-speed centrifugal experiment, the calculation formulas of core water saturation, phase relative permeability of gas-water under different centrifugal force are established. A new method of "nuclear magnetic resonance + high-speed centrifugation" for gas-water relative permeability curve test of low-permeability and tight sandstone is formed, and the test is carried out on Sulige low-permeability tight sandstone core. The results show that: (1) The shape of cumulative distribution curve of throat radius by mercury injection method is basically consistent with that of T2 relaxation time by NMR, and there is a good corresponding relationship between them. (2) The centrifugation process is similar to the gas displacing water process. With the decrease of water saturation, water centrifugation in rock core becomes more and more difficult until it become irreducible. (3) The test process of the new method is unified and standard and up to 6 cores can be tested at the same time. The calculation results of water saturation and relative permeability curve are reliable and the integral curve is smooth, which greatly improves the test efficiency of gas-water relative permeability curve in low-permeability and tight sandstone. The new method can be widely used to study the gas-water two-phase seepage law in low-permeability and tight sandstone gas reservoir.

A model for enabling the production of lower carbon cement paste is proposed in this research. The model is based on predicting the strength of cement pastes with partial replacement of wheat straw ash (WSA) and silica fume (SF), two major wastes of agricultural and industrial production. The model is set up based on response surface methodology and Box-Behnken design, and included a suite of mechanical tests with distinct replacements following a micro an meso characterization. The model shows capability for predicting strength of any cement paste, including partial substitution of WSA and/or SF at any combination level with excellent accuracy, which is verified with three validation mixtures demonstrating maximum errors of less than 6% at the three ages. The analysis of the response surface evidences that any cement replacement in the range of 0-20% WSA and above 5% SF allows the reduction of the carbon footprint by maximizing the incorporation of both wastes. The proposed model can be used by setting the required strength of cement paste and calculating the maximum possible replacement, which should contribute to making the construction industry more sustainable by utilizing local waste.

A new clothing resistance model is described and applied to characterize the human thermal and moisture climates. The climate was described by the thermal (rcl,t) and evap-orative (rcl,e) resistances of comfortable, imaginary clothing. The key input variable of the model is the rate of sweating (λEsw). Since sweating is an individual-specific process, the model applies to the individual. The observations were carried out by a single individual in Martonvásár (Hungarian lowland, Central Europe) in the summer of 2023 and the winter of 2024. During the observations, the observer walked at a speed of 1.1-1.7 ms-1 in weather-appropriate clothing. Among the results, we would highlight the following: Dur-ing large environmental heat surpluses, the rcl,t values were found to be between 0.1-0.5 clo-t (clo-t = 0.155 m2·℃·W-1), while the rcl,e values fell between 0.4-0.8 clo-e (clo-e = 0.155 m2·hPa·W-1). The values of the parameters close to 0 were caused by intense sweating (λEsw > 200 Wm-2). The applicability of the model is limited and largely depends on the rela-tionship between λEsw and the metabolic heat flux density.

The paper describes an application of machine learning approach for parameter optimization. The method is demonstrated for the elasto-viscoplastic model with both isotropic and kinematic hardening. It is shown that the proposed method based on long-short term memory networks enabled to obtain reasonable agreement of stress-strain curves for cyclic deformation in low-cycle fatigue regime. The main advantage of the proposed approach over traditional optimization schemes lies in the possibility to get parameters for a new material without the necessity to conduct any further optimizations. As the power and robustness of the developed method was demonstrated on the very challenging problem (cyclic deformation, crystal plasticity, self-consistent model, isotropic and kinematic hardening), it is directly applicable to other experiments and models.

Abstract—The static and fatigue analysis of plates with holes, made of 2D woven roving composites, is conducted. The parametrization of convex holes is proposed. Experimental results of specimens without holes and with different shapes of notches are discussed. The fatigue behaviour is considered with the use of the low cycle fatigue method. The analysis is supplemented by the numerical finite element modeling. The present work is an extension of the results discussed in the literature. The finite element modeling of plates with holes is presented in details in Ref [1-3] including also the problems of the accuracy. The experimental results and the form of specimens are shown in Ref [4]. Two parametrical description of static and fatigue behaviour of plates with holes characterizes the goal and the novelty of the paper. The fuzzy approach is employed to reduce the number of experimental data [5].

While providing safe water for the rural poor is considered a basic human right, there are numerous issues associated with existing technologies with shortcomings. Performance issues have continued to fail to meet the needs of impoverished families due to issues including high cost, difficulties with performance, and continuing needs for maintenance. These issues have severely interfered the safe water accessibility. Key aspects of the Guelph Water Filter (GWF) system can avoid/minimize many of these issues. The GWF as described herein enables delivery of low cost, long-term performance at 3Log removal of E.coli and can deliver 1 to 3 L of treated water per hour. The GWF is simple to operate, has an ability to provide sufficient water for a family, maintains longevity of performance, is easy to maintain and has protection against breakage during the cleaning process, is repairable at village level, and operates using a sizable reservoir of water to supply raw water, meaning the technology does not need to be refilled frequently. Hence, the capability of the novel GWF technology is shown to bypass many of the troublesome features of alternative low-tech water treatment technologies. The potential for the GWF to function for 2 days continuously avoids the need for young girls to fetch raw water frequently during a day, thereby enabling them to attend school. Hence, the GWF enhances the potential to result in ‘safe water and full schools’, providing the opportunity for girls to receive education and capture socio-economic benefits for the community.