The morbidity and mortality caused by invasive fungal infections is increasing across the globe due to developments in transplant surgery, the use of immunosuppressive agents, and the emergence of drug-resistant fungal strains, which has led to a challenge in terms of treatment due to the limitations of three classes of drugs. Hence, it is imperative to establish effective strategies to identify and design new antifungal drugs. Drug repurposing is an effective way of expanding the application of existing drugs. In the last years, various existing drugs have been shown to be useful in the prevention and treatment of the invasive fungi. In this review, we summarize the currently used antifungal agents. In addition, the most up to date information on the effectiveness of existing drugs with antifungal activity is discussed. Moreover, the antifungal mechanisms of existing drugs are highlighted. These data will provide valuable knowledge to stimulate further investigation and clinical application in this field.

This study aims to verify the time-variant feature of American ginseng (AG) continuous cropping obstacles and to explore the factors impeding continuous cropping. We verified the feature with a plant-soil feedback pot experiment and then investigated the factors by comparing the properties of control soils that had not been previously used for growing ginseng (CS) with those of soils with a 10-year-crop-rotation cycle following the growth of AG (RS). It’s found that the survival rate of AG in RS was lower than that in CS. The RS had lower pH, available potassium content, and urease activity. Additionally, p-coumaric, p-hydroxybenzoic, vanillic, caffeic, and cinnamic acid levels were lower in RS than in CS, but salicylic acid levels showed the opposite pattern. RS had higher Rhodanobacter and lower Acidothermus, Sphingomonas relative abundances in bacterial community. It’s also found that many bacteria were substantially correlated with phenolic acids and soil physiochemical properties. Results indicate that even after 10-year crop rotation, the negative effects of prior continuous cropping of AG has not been eliminated. The growth of AG can be affected negatively with deterioration of soil physicochemical properties and with lower levels of phenolic acids which promote pathogen reproduction. Probiotics reduction also weighs. Moreover, biotic factors are interrelated with abiotic ones. Therefore, it can be inferred that the comprehensive change of soil properties is the main obstacle for continuous cropping.

North and West Africa are the most vulnerable regions to drought, due to the high variation in monthly precipitation. An accurate and efficient monitoring of drought is essential. In this study, we use TRMM data with remote sensing tools for effective monitoring of drought. The Drought Severity Index (DSI), Temperature Vegetation Drought Index (TVDI), Normalized Difference Vegetation Index (NDVI), and Normalized Vegetation Supply Water Index (NVSWI) are more useful for monitoring the drought over North and West Africa. To classify the areas affected by drought, we used the TRMM spatial maps to verify the TVDI, DSI and NVSWI indexes derived from MODIS. The DSI, TVDI, NVSWI and Monthly Precipitation Anomaly (NPA) indexes with the employ of MODIS-derived ET/PET and NDVI were chosen for monitoring the drought in the study area. The seasonal spatial correlation between the DSI, NPA, NVWSI, NDVI, TVDI and TCI indicates that NVSWI, NDVI and DSI present an excellent monitor of drought indexes. The change trend of drought from 2002 to 2018 was also characterized. The frequency of drought showed a decrease during this period.

We present the generation and nonlinear frequency conversion of nanosecond cylindrical vector beams (CVBs) in two-mode fiber (TMF). Based on the polarized dependence vector mode coupling characteristic and the precise wavelength tunability of an acoustically-induced fiber grating (AIFG), the nanosecond cylindrical vector beams (CVBs, 1064 nm, 10 ns) is directly generated in a TMF with convenient switching characteristics between the radial and azimuthal vector beams. Furthermore, the stimulated Raman scattering (SRS) is produced based on the transmission of the nanosecond CVBs in the 100-meters long TMF, and the spatial intensity and polarization distributions characteristics the 1st-order Stokes shifted component is consistent with the nanosecond CVBs pump pulse. This work provides a method for achieving wavelength conversion of the CVBs in optical fiber.

A new di-mannitol adipate ester-based zinc metal alkoxide (DMAE-Zn) was synthesized as a bi-functional PVC thermal stabilizer for the first time. The materials were characterized with Fourier-transform Infrared spectroscopy (FT-IR) and thermogravimetric analysis (TGA). Characterization results confirmed the formation of Zn-O bonds in DMAE-Zn; and that DMAE-Zn had a high decomposition temperature and a low melting point. The thermal stability of DMAE-Zn on PVC also was tested by conductivity test, thermal aging test, and UV-visible spectroscopy (UV-VIS) test. PVC stabilized by DMAE-Zn had a good initial color and excellent long-term stability. UV-VIS also showed that the conjugated structure in PVC stabilized by DMAE-Zn was almost all of the triene, suggesting that the addition of DMAE-Zn would suppress the formation of conjugated structures above tetraene. Dynamic processing performance of PVC samples tested by torque rheometer indicated that, having a good compatibility with PVC chains in the amorphous regions, DMAE-Zn contributed good plasticizing effect to PVC. DMAE-Zn thus effectively demonstrates bi-functional roles, e.g., thermal stabilizers and plasticizers to PVC. Furthermore, FT-IR, HCl absorption capacity test, and complex ZnCl₂ test were also used to verify the thermal stability mechanism of DMAE-Zn for PVC.

Polypropylene (PP) foam has a great deal of application since it normally exhibits non-uniform cell size distribution, low cell density, and cracked cells. In this study, a small amount of fluoroelastomer (FKM) was used as a nucleating agent to prepare well-defined microporous PP foam by supercritical CO₂. It was observed that solid FKM was present as the nanoscale independent phase in PP matrix and the FKM could induce a mass of CO₂ aggregation, which significantly enhanced the diffusion rate of CO₂ in PP. The resultant PP/FKM foams exhibited much smaller cell size (～24 μm), and more than 16 times cell density (3.2×10⁸ cells/cm³) as well as a much more uniform cell size distribution than that of the neat PP foam. PP/FKM foams possessed major concurrent enhancement in their tensile stress and compressive stress compared to neat PP foam. We believed that the added FKM played a key role in enhancing the heterogeneous nucleation, combined with the local strain field variation in the multiple-phase system, which was responsible for the considerably improved cell morphology of PP foaming. This paper provides a deep understanding of the scCO₂ foaming behavior of PP in the presence of FKM.

Japanese encephalitis is a zoonotic disease caused by Japanese encephalitis virus (JEV). It is mainly epidemic in Asia with an estimated 69,000 cases occurring per year. However, no approved agents are available for the treatment of JEV infection, and existing vaccines cannot resist various types of JEV strains. Drug repurposing is a new concept for finding new indication of existing drugs, and recently, it has been used to discover new antiviral agents. Identifying host proteins involved in the progress of JEV infection and using these proteins as targets are the center of drug repurposing for JEV infection. In this study, based on the gene expression data of JEV infection and the phenome-wide association study (PheWAS) data, we identified 286 genes participating in the progress of JEV infection using the systems biology methods. The enrichment analysis of these genes suggested that the genes identified by our methods were predominantly related to viral infection pathways and immune response-related pathways. We found that bortezomib which can target these genes may have potential effect on the treatment of JEV infection. Subsequently, we evaluated the antiviral activity of bortezomib using the JEV-infected mice model. The results showed that bortezomib can lower JEV-induced lethality in mice, alleviate suffering in JEV-infected mice and reduce the damage in brains caused by JEV infection. This work provides a new method for the development of antiviral agents.

A supramolecular host-guest interaction and sensing between cationic pillar[5]arenes (CP5) and L-carnitine were developed by the competitive host-guest recognition for the first time. The fluorescence sensing platform was constructed by CP5 functionalized Au nanoparticles (PP5@Au-NPs) as receptor and probe (rhodamine 123, R123), which shown a high sensitivity and selectivity to L-carnitine detection. Due to the property of the negative charge and molecular size of L-carnitine, it can be highly captured by the CP5 via electrostatic interactions and hydrophobic interactions. The mechanism of host-guest between PP5 and L-carnitine was studied by ¹H NMR and molecular docking, which indicated more affinity binding force of PP5 with L-carnitine. Therefore, a selective and sensitive fluorescent method was developed. It has a linear response of 0.1–2.0 and 2.0–25.0 μM and a detection limit of 0.067 μM (S/N = 3) for L-carnitine. The fluorescent sensing platform was also used to detect L-carnitine in human serum and milk samples, which provided potential applications of detection drugs of abuse, and had path for guarding a serious food safety issues.

Ischemia stroke is one of a clinically common cerebrovascular disease. And Inhibition of brain tissue ischemia and reperfusion-induced damage, especially apoptosis, has an irreplaceable protective effect on ischemic nerves, and has special significance for the treatment of patients after treatment. However, the development of neuroprotective drugs still has certain challenges. Radix scrophulariae as a valuable medicine, has been discovered to has neuroprotective effects. Our researches initially proved that Radix scrophulariae aqueous extract (RSAE) exerting a neuroprotective effects on cerebral ischemia and reperfusion (I/R) injury in oxygen glucose deprivation and reperfusion (OGD/R)-induced PC12 cells and middle cerebral artery occlusion/reperfusion (MCAO/R) model mice, were associated with attenuation of infarct volume, brain water content, nitric oxide (NO) and malondialdehyde (MDA), inhibiting I/R-induced damage by reducing the levels of LDH release, improving anti-oxidant capacity by upregulating the SOD, GSH-Px and CAT activity, stabilizing mitochondrial membrane potential, reducing neuronal apoptosis, necrosis and neuronal loss by regulating the expression of anti-apoptotic BCL-2and pro-apoptotic protein Bax, and elucidating downregulate the phosphorylation levels of MAPK pathways. Our findings may elaborate the neuroprotective effects and potential mechanisms of RSAE on focal cerebral I/R injury in mice. Since, Radix scrophulariae, as a potential neuroprotective natural plant, has originally been identified to, our results may offer directions and clues for discovering new active compounds or drugs for treatment of ischemic stroke, which allows us to discover many new natural active chemicals by chemical separation and identification, and provide new insights into therapeutic targets in stroke patients.

The utilization for water resource has been of great concern to human life. To assess the natural water system in Kangding County, the integrated methods of hydrochemcial analysis, multivariate statistics and geochemical modelling were conducted on surface water, groundwater and thermal water samples. Surface water and groundwater were dominated by Ca-HCO₃ type, while thermal water belonged to Ca-HCO₃ and Na-Cl type. The analyzing results concluded the driving factors that affect hydrochemical components. Following the results of the combined assessments, hydrochemcial process was controlled by the dissolution of carbonate and silicate minerals with slight influence from anthropogenic activity. The mixing model of groundwater and thermal water was calculated using silica-enthalpy method, yielding cold-water fraction of 0.56-0.79 and estimated reservoir temperature of 130-199 ^oC, respectively. δD and δ¹⁸O isotopes suggested surface water, groundwater and thermal springs were of meteoric origin. Thermal water should have deep circulation through the Xianshuihe fault zone, while groundwater flows through secondary fractures where it recharges with thermal water. Those analytical results were used to construct a hydrological conceptual model, providing a better understanding of the natural water system in Kangding County.

Improved understanding of climate-growth relationships of multi-species is fundamental to understand and predict response of forest growth to future climate change. Forests are mainly composed of conifers in Northwestern Yunnan Plateau, but variations of growth response to climates among the species are not well understood. To detect growth response of multiple species to climate change, we developed residual chronologies of four major conifers, i.e. Abies georgei, Picea likiangensis, Pinus densata and Larix potaninii at upper distributional limits in Shika Snow Mountain. By using dendroclimatology method, we analyzed correlations between the residual chronologies and climate variables. The results showed that conifer radial growth was influenced by both temperature and precipitation in Shika Snow Mountain. Previous November temperature, previous July mean maximum temperature (T_max) and current June precipitation were the common climatic factors, which had consistent influences on radial growth of four species. Temperature in previous post growing season (September–October) and current growing season (June-August), and precipitation in previous August were the common climatic factors, which had divergent impacts on four species radial growth. Current May T_max and early growing season (April-May) precipitation showed positive and negative influences on growth of P. likiangensis, respectively. Temperature in current post growing season positively affected growth of A. georgei. According to the prediction of climate models and our understanding in growth response of four species to climate variables, we may understand growth response to climate change at species level. It is difficult to predict future forest growth in the study area, since future climate change might cause both increases or decreases for four species and indirect effects of climate change on forest should be considered.

A fast and effective determination method of different species of vegetable seeds oil is vital in the plant oil industry. The near-infrared reflectance spectroscopy (NIRS) method was developed in this study to massively analyze the oil and moisture contents of Camellia gauchowensis Chang and C. semiserrata Chi seeds kernels. In the prediction models of NIRS, the levels of accuracy obtained were sufficient for C. gauchowensis Chang and C. semiserrata Chi, the correlation coefficient of which oil were 0.983 and 0.962, respectively, while which of moisture were 0.937 and 0.907, respectively. The near infrared spectrum of crush seeds kernels was more precise compared to intact kernels. Based on the calibration models of the two Camellia species, the NIRS predictive oil contents of C. gauchowensis Chang and C. semiserrata Chi seeds kernels were 48.71 ± 8.94% and 31.71 ± 7.39%, respectively, and the NIRS predictive moisture contents were 4.39 ± 1.08% and 3.49 ± 0.71%, respectively. Compared with the traditional chemical measurement, the rapid, precise measurement of oil and moisture of C. gauchowensis Chang and C. semiserrata Chi seeds kernels can be actualized by NIRS method.

3D reality capturing has demonstrated increased efficiency and consistently accurate outcomes in architectural digitisation. Nevertheless, despite advancements in data collecting, 3D reality capturing still lacks full automation, especially in the post-processing and modelling phase. Artificial intelligence (AI) has been a significant focus, especially in computer vision, and tasks such as image classification and object recognition might be beneficial to the digitisation process and its subsequent utilisation. This article aims to examine the potential outcomes of integrating AI technology into the field of 3D reality-capturing, with a particular focus on its use in architectural scenarios. The main methods used for data collection are laser scanning (static or mobile) and photogrammetry. As a result, image data including RGB-D data (files containing both RGB colours and Depth information) and point clouds have become the most common raw datasets available for object mapping. The study comprehensively analyses the current use of 2D and 3D deep learning techniques in documentation tasks, particularly downstream applications. It also highlights the ongoing research efforts in developing real-time applications with the ultimate objective of achieving generalisation and improved accuracy.

Photoacoustic imaging (PAI) is a cutting-edge biomedical imaging modality, providing detailed anatomical and functional information about the area beneath the skin surface. Its light energy deposition is such that PAI typically provides clear images of the skin with high signal-to-noise ratios. Specifically, the rich optical contrast of PAI allows biological information related to lesion growth, malignancy, treatment response, and prognosis to be seen. Given its significant advantages and emerging role in imaging skin lesions, we summarize and comment on representative studies of skin PAI, such as the guidance of skin cancer biopsies and surgical excisions, and the accurate diagnosis of psoriasis. We conclude with our insights about the clinical significance of skin PAI, showing how its use to identify biological characteristics in lesion microenvironments allows early diagnosis and prognosis of disease.

With the economic recession and the deterioration of the ecological environment becoming more and more prominent in the world, the sustainable operation of enterprises is facing the most difficult choice in history. For each responsible enterprise, it is crucial to choose the market power expansive strategy that can improve the realistic viability or the technological innovation strategy that can improve the future development potential. This is of great significance to reduce the negative external effects of the corporate social environment and ensure their sustainable development. In this paper, we select the data of 18 large listed petrochemical companies from 2003 to 2018 as samples and construct a linear regression model for empirical analysis. Meanwhile, we put forward more practical business management strategies for the sustainable development of petrochemical enterprises in developing countries in further research.

The Woka-Cuona rift zone, situated in the easternmost portion of southern Tibet, displays complex geological conditions. It consists of three distinct grabens or half grabens, spanning the Himalayan and Gangdese terranes from south to north. Examining the distribution patterns and genetic mechanism of the geothermal system in the Woka-Cuona rift zone holds significant guidance for studying the genetic mechanisms of geothermal systems and the production and utilization of ge-othermal resources in the rift zones of southern Tibet. Based on the geological conditions of the study area, the mechanism of rift formation and the distribution characteristics of geothermal water in the three distinct grabens were analyzed through data collection, ground surveys, geochemical analysis, and isotope analysis. Alongside topographic, drainage, and structural features, the Woka-Cuona rift zone was subdivided into four zones from north to south - Woka, Qiongduojiang, northern Cuona, and southern Cuona grabens. Additionally, the study investigated the geochemical char-acteristics, recharge sources, and water-rock interactions of geothermal water in different zones, providing a scientific foundation for subsequent geothermal energy production.

We propose Context-aware Feature Transformer Network (CaFTNet), a novel network for human pose estimation. To address the issue of limited modeling of global dependencies in convolutional neural networks, we design Transformerneck to strengthen the expressive power of features. Transformerneck directly substitutes the 3×3 convolution in bottleneck of HRNet with Contextual Transformer (CoT) block, while reducing the complexity of the network. Specifically, CoT first produces keys with static contextual information through 3×3 convolution. Then, relying on the query and contextualization keys, the dynamic contexts are generated through two concatenated 1×1 convolutions. Static and dynamic contexts are eventually fused as an output. Additionally, for the multi-scale networks, in order to further refine the features of the fusion output, we propose an Attention Feature Aggregation Module(AFAM). Technically, given an intermediate input, AFAM successively deduces attention maps along channel and spatial dimensions. Then, Adaptive refinement module(ARM) is exploited to activate the obtained attention maps. Finally, the input undergoes adaptive feature refinement through multiplication with the activated attention maps. Through the above studies, our lightweight network provides a powerful clue for detection of keypoints. Experiments are implemented on the COCO and MPII datasets. The model achieves 76.2 AP on the COCO val2017. Compared to other methods with the CNN as the backbone, CaFTNet reduces the number of parameters by 72.9 %. On the MPII, our method uses only 60.7% of the number of parameters, acquiring semblable results to other methods with the CNN as the backbone.

This paper investigates the relationship between public debt and economic growth in the context of a panel kink regression with latent group structures. The proposed model allows us to explore the heterogeneous threshold effects of public debt on economic growth based on unknown group patterns. We propose a least squares estimator and demonstrate the consistency of estimating group structures. The finite sample performance of the proposed estimator is evaluated by simulations. Our findings reveal that the nonlinear relationship between public debt and economic growth is characterized by a heterogeneous threshold level, which varies among different groups, and highlight that the mixed results found in previous studies may stem from the assumption of a homogeneous threshold effect.

This paper investigates the critical factors for balancing environmental sustainability and economic development through the lens of New Structural Economics. Specifically, we utilize the congruence index to access the alignment between local factor endowment structure and firm production input structure. Using a comprehensive manufacturing firm-level pollutant emissions dataset from the Yangtze River Economic Belt (YEB) region in China, we find that firms demonstrating higher congruence exhibit improved economic performance and alignment with comparative advantages. This not only contributes to increased economic efficiency for these firms but also leads to a reduction in pollutant emissions, including wastewater discharge and Chemical Oxygen Demand (COD) emissions. Our study provides valuable insights into achieving mutually beneficial environmental and economic outcomes.

With the development of electricity spot markets, accurate electricity load forecasting enables power generation companies to supply the right amount of electricity, Significantly avoid power waste. As a result, time series forecasting in the field of power can bring significant benefits. Previously, the Informer model successfully introduced the Transformer into long time series forecasting(LTSF) by proposing the ProbSparse self-attention mechanism, which solved the inherent problem of high memory complexity in self-attention. Recent research has further demonstrated the potential of the self-attention for mining complex dependencies. However, the limited amount of historical data has become one of the main challenges in applying deep learning techniques to power LSTF tasks. Previous reserches often add a large number of time covariates to provide more information. In this paper, to address this issue, (i) we design a simple but effective Season-aware Block to enhance the model’s ability to mine artificial prior information in temporal covariates; (ii) we conduct experiments using the provincial power data of Zhejiang Province, China, from 2019 to 2022, and our model outperforms other models, achieving a 19 percent MSE relative improvement; (iii) we conduct ablation experiments to assess the efficacy of the Season-aware Block in extracting temporal periodic features. Furthermore, we elucidate the underlying reasons for the effectiveness of both the self-attention mechanism and the Season-aware Block through visualization experiments.

In this paper, we shall introduce the interval-valued spatial error model. Based on the idea of least square method of single-valued case, we give the parameter estimator for interval-valued spatial error model. The theoretical properties of the proposed estimator are proved. Finally, we give the numerical analysis and a real example.

This paper proposes to combat active eavesdropping by intelligent reflecting surface (IRS) backscatter techniques. To be specific, the source (Alice) sends the confidential information to the intended user (Bob), while the eavesdropper (Willie) transmits jamming signal to interrupt the transmission for more data interception. To enhance the secrecy, an IRS is deployed and connected with Alice through fiber to transform the jamming signal into the confidential signal by employing backscatter techniques. Based on the considered model, an optimization problem is formulated to maximize signal-to-interference-plus-noise ratio (SINR) at Bob under the constraints of the transmit power at Alice, the reflection vector at the IRS and the allowable maximum SINR at Willie. To address the optimization problem, an alternate optimization algorithm is developed. The simulation results verify the achievable secrecy gain of the proposed scheme.

Multispectral image (MSI) and hyperspectral image (HSI) fusion (MHIF) aims to address the challenge of acquiring high-resolution (HR) HSI images. This field combines a low-resolution (LR) HSI with an HR-MSI to reconstruct HR-HSI. Existing methods directly utilize transformers to perform feature extraction and fusion. Despite the demonstrated success, there exist two limitations: 1) Employing the entire transformer model for feature extraction and fusion fails to fully harness the transformer’s potential in integrating the spectral of the HSI and spatial information of the MSI. 2) HSI has a strong spectral correlation and exhibits sparsity in the spatial domain. Existing transformer-based models do not optimize this physical property, which makes their methods prone to spectral distortion. To accomplish these issues, this paper introduces a novel framework for MHIF called Sparse Mix-Attention Transformer (SAMformer). Specifically, to fully harness the advantages of the Transformer architecture, we propose a Spectral Mix Attention Block (SMAB), which concatenates the keys and values extracted from LR-HSI and HR-MSI to create a new multi-head attention module. This design facilitates the extraction of detailed long-range information across spatial and spectral dimensions. Besides, to address the spatial sparsity inherent in HSI, we incorporated a sparse mechanism within the core of SMAB called Sparse Spectral Mix Attention Block (SSMAB). In the SSMAB, we compute attention maps from queries and keys and select the K highly correlated values as the sparse attention map. This approach enables us to achieve a sparse representation of spatial information while eliminating spatially disruptive noise. Extensive experiments conducted on three benchmark datasets, namely Cave, Harvard, and Pavia Center, demonstrate the SMAformer method outperforms state-of-the-art methods.

Attack investigation is an important research field in forensics analysis. Many existing supervised attack investigation methods rely on well-labeled data for effective training. While the unsupervised approach based on BERT can mitigate the issues, the high degree of similarity between certain real-world attack and normal behaviors makes it challenging to accurately identify disguised attacks. This paper proposes ConLBS, an attack investigation approach that combines the contrastive learning framework and multi-layer Transformer network to realize the classification of behavior sequences. Specifically, ConLBS constructs behavior sequences describing behavior patterns from audit logs, and a novel lemmatization strategy is proposed to map the semantics to the attack pattern layer. Four different augmentation strategies are explored to enhance the differentiation between attack and normal behavior sequences. Moreover, ConLBS can perform unsupervised representation learning on unlabeled sequences, and can be trained either supervised or unsupervised depending on the availability of labeled data. The performance of ConLBS is evaluated in two public datasets. The results show that ConLBS can effectively identify at-tack behavior sequences in the cases of unlabeled data or less labeled data to realize attack investigation, and achieve the superior effectiveness compared to existing methods and models.

Cloud detection in remote sensing images is a crucial preprocessing step that efficiently identifies and extracts cloud-covered areas within the images, ensuring the precision and reliability of subsequent analyses and applications. Given the diversity of clouds and the intricacies of the surface, distinguishing the boundaries between thin clouds and the underlying surface is a major challenge in cloud detection. To address these challenges, an advanced cloud detection method, CloudformerV3, is presented in this paper. The proposed method employs a multi-scale adapter to incorporate dark and bright channel prior information into the model's backbone, enhancing the model's ability to capture prior information and multi-scale details from remote sensing images. Additionally, multi-level large window attention is utilized, enabling high-resolution feature maps and low-resolution feature maps to mutually focus and subsequently merge during the resolution recovery phase. This facilitates the establishment of connections between different levels of feature maps and offers comprehensive contextual information for the model's decoder. Experimental results on the GF1_WHU dataset demonstrate that the method introduced in this paper exhibits superior detection accuracy when compared to state-of-the-art cloud detection models. Furthermore, enhanced detection performance is achieved along cloud edges and with respect to thin clouds, showcasing the efficacy of the proposed method.

Rollover prevention of partially-filled tank trucks is an industry teaser, with the core challenge being real-time perception and observation of the liquid state inside the tank. In order realize re-liable observation of sloshing liquid, this article firstly proposes a sloshing modeling method based on multi-degree-of-freedom pendulum model, and derives the double mass trammel pendulum model (DMTP, 2DOF) accordingly, which accurately reflects the sloshing dynamics under more pervasive working conditions. Secondly, a free surface fluctuation sensor is designed based on magnetostriction, capable of measuring the inclination and height of the liquid level inside tanks filled with hazardous chemical. Finally, the unscented Kalman filter (UKF) is utilized to synthesize the information of the two, establishing a credible real-time observation of the sloshing liquid. Verified through vehicle-fluid coupled co-simulation, under condition of con-secutive double lane change, observation error of the proposed method is only 25.9% that of the open-loop calculation, providing a secure guarantee for the observation of the state variables of the single pendulum model (SP) used for most kinds of anti-rollover controller.

incipient fault diagnosis is particularly important in process industrial systems, as its early detection helps to prevent major accidents. Against this background, this study proposes a combined method of Mixed Kernel Principal Components Analysis and Dynamic Canonical Correlation Analysis (MK-DCCA). The robust generalization performance of this approach is demonstrated through experimental validation on a randomly generated dataset. Furthermore, Comparative experiments were conducted on a CSTR Simulink model, comparing the MK-DCCA method with DCCA and DCVA methods, demonstrating its excellent detection performance for incipient fault in nonlinear and dynamic system. Meanwhile, fault identification experiments were conducted, validating the high accuracy of fault identification method based on contribution. The experimental findings demonstrate that the method possesses a certain industrial significance and academic relevance.

CuO/ZnO/Al2O3 catalyst is a commonly used catalyst for rea methanol steam reforming reaction. Oxalic acid was as precipitant in preparing oxalate precursor of CuO/ZnO/Al2O3 catalyst by co-precipitation, deionized water and ethanol were as solvents, microwave irradiation and water bath were as aging heating manner respectively. It indicated that ethanol selected crystal phase composition of oxalate precursors and restricted their growth. Microwave irradiation prompted the isomorphous substitution between Cu2+ of CuC2O4 and Zn2+ of ZnC2O4 in mother liquid, forming the master phase (Cu,Zn)C2O4 in precursor, the solid solution Cu-O-Zn formed after calcination, which exhibited nano-fibriform morphology. It possessed small CuO grains, large surface area and strong synergy between CuO and ZnO, which is beneficial to improve the catalytic performance of methanol steam reforming, the STY of H2 reached 516.7 mL·g-1·h-1, and the selectivity of CO was only 0.29%.

Underwater acoustic sensor network (UASN) plays a crucial role in collecting real-time data from remote areas of the ocean. However, deploying the UASN is a challenging problem due to the harsh environment and high deployment cost. Therefore, it is essential to design an appropriate routing protocol to effectively address the issues of routing void, packet delivery delay, and energy utilization. In this paper, an adaptive support-vector-machine-based routing (ASVMR) protocol is proposed for the UASN to prolong the network lifetime and reduce the end-to-end packet delivery delay. The proposed protocol employs a distributed routing approach that dynamically optimizes the routing path in real-time by considering four types of node state information. Moreover, the ASVMR protocol establishes a "routing vector" spanning from the current node to the sink node, and selects a suitable pipe radius according to the packet delivery ratio (PDR). In addition, the ASVMR protocol incorporates future states of sensor nodes into the decision-making process, along with the adoption of a waiting time mechanism and routing void recovery mechanism. Extensive simulation results demonstrate that the proposed ASVMR protocol performs well, in terms of the PDR, the hop count, the end-to-end delay, and the energy efficiency in dynamic underwater environments.

ccurate recording of growth indicators for aquaculture species at different stages is essential for evaluating aquaculture production effectiveness and the rationality of feed formulations. Due to their convenience and non-invasiveness, weight, length, and condition factor are commonly used to assess the growth of aquaculture species . However, fish growth indicators, can vary significantly with age structure and feed components(nutrition), and relying on a single indicator may lead to misjudgments . In this study we investigated the growth indicators of gibel carp (Carassius auratus gibelio var. CAS V) at different growth stages (juvenile and adult) and different feed formulations. Meanwhile, fish weight-length relationship () was used to assess the growth indicators. The results showed that the weight-length relationship of gibel carp varied significantly with age and feed formulations. Additionally, the condition factor calculated depended on the weight-length relationship was more consistent with weight/length changes than measured. Weight analysis indicated that both weight, length, height, back thickness, and carcass ration had higher weights in analyzing fish growth. Therefore, during aquaculture production, fish growth evaluating requires considering diverse indicators such as weight, length,body height, back thickness, carcass ration,as well as condition factor to avoid misjudging the actual growth situation. Meanwhile, the use of the condition factor should consider the sufficient amount of data and whether the assumptions (such as being in a isometric growth period) are met.

Physical layer secret key (SK) generation is known to be an efficient means to achieve high secrecy rate, on the condition that dynamic channel state information (CSI) is provided. For this reason, the secrecy performance is highly degraded in a static environment. The intelligent reflecting surface (IRS) is a promising solution to create dynamic randomness, and thus lead to enhanced secrecy performance regardless of the user environments. This paper proposes an IRS-assisted physical layer SK generation scheme, by efficiently combing phase information of the direct and reflected channel information in a hybrid way. In particular, the initial SKs are obtained by adopting efficient phase quantization method with symmetric bit allocation to complex numbered channel estimates. Simulation results show that the proposed hybrid phase quantization (PQ) can improve the SK generation rate and the key disagreement probability in a static environment.

Nickel-based Superalloy Inconel 718 is widely used in the aerospace industry for its excellent high-temperature strength and thermal stability. However, milling Inconel 718 presents challenges due to significantly increased cutting force and vibration, which is a typical difficult-to-machine material. This paper focuses on the milling process of Inconel 718, establishing a milling force model to analyze the force trends under various processing parameters. Finite element analysis is employed to study the stress and temperature fields during milling. Dynamic equations for milling Inconel 718 are developed, and stability lobe diagrams are generated based on modal experiments. Milling experiments on Inconel 718 validate the milling force model and finite element analysis results. The fmincon optimization algorithm is utilized to identify the optimal machining parameters for Inconel 718. Through this research, valuable insights into enhancing the efficiency and quality of Inconel 718 machining are provided. This study contributes to a deeper understanding of Inconel 718 milling behavior, offering crucial guidance for more efficient machining processes.

In order to reduce the silique shattering loss of rapeseed mechanical harvesting process, based on the state of force on the silique during rapeseed harvesting reel branch, Ningza 1810, Zhenyou 8 and Fengyou 306 were used as research objects, and the experimental research on the factors affecting rapeseed siliques shattering was carried out using the swing impact method. The experimental analysis showed that: rapeseed varieties, silique moisture content, silique growth position, collision material, impact speed, force position and other factors had significant effects on silique shattering. The impact velocity was less than 1.5m·s-1, the difference on the effect of each factor on pod-shattering was not significant, it was not easy to shatter when the moisture content of rapeseed silique was higher. The impact resistance of the front side of rapeseed was 2 to 4 times that of the bonding surface of rapeseed petals, the shattering rate of the top rapeseed silique was twice that of the bottom siliques, when siliques were supported, they were more likely to shatter under external forces than when they were unsupported. The experimental study of the mechanical properties of rapeseed siliques was carried out using the impending fracture method, the experimental analyses showed that the support position and force position of the silique, the loading speed and the growth position of the silique had a significant effect on the mechanical properties of the silique. The maximum cracking force was higher and bending strength was stronger when the body of the silique was supported, which the range of the maximum cracking force were 3.05N to 4.16N, and the bending strength range were 8.48 MPa to 11.57 MPa. The maximum cracking force and bending strength of the silique was stronger when the front side of the silique petal was pressurized than when the bonding surface of the petal was pressurized. Based on Pearson's correlation and grey correlation analysis, the morphological characteristics of rapeseed siliques were ranked in order of their influence on the performance of siliques in terms of the angle between silique and stalk, stalk diameter, petal thickness, beak length, silique thickness, silique width and silique length. This study can be used as a reference for the design and optimization of the rapeseed harvesting reel branch mechanism and the selection of machine harvestable rapeseed varieties.

In the era of persistent globalization, climate governance has emerged as a prominent concern within both the theoretical community and government departments of diverse nations. Of particular interest in academic research is the adverse effect of climate shocks on the global economy. This paper employs average temperature as a surrogate indicator for climate shocks and examines the influence of temperature fluctuations on inflation levels using a balanced panel dataset from 1995 to 2021. The findings indicate a positive association between temperature change and inflation within the country, which remains consistent even after subjecting the analysis to multiple robustness tests. Furthermore, accounting for heterogeneity reveals variations in the magnitude of response of inflation levels to temperature fluctuations. Regarding the analysis of underlying mechanisms, the study underscores the significance of energy demand as a pivotal pathway influencing inflationary pressures at the national level. Lastly, by incorporating GDP per capita as a threshold, the research reveals a nonlinear relationship between temperature change and inflation levels.

Cancer is a common illness with a high mortality. Compared to traditional technologies, biomarkers detection, with low cost and simple operation, has higher sensitivity and faster speed in early screening and prognosis of cancer. Therefore, extensive research has been focused on the development of biosensors and the construction of sensing interfaces. Molybdenum disulfide (MoS2) is a promising two-dimensional (2D) nanomaterial, whose unique adjustable bandgap shows excellent electronic and optical properties in the construction of biosensor interfaces. It not only has the advantages of high catalytic activity and low manufacturing costs, but also can further expand the application of hybrid structures by different functionalization, and is widely used in various biosensors fields. Herein, the application of electrochemical and optical sensing platforms based on MoS2 in the detection of cancer biomarkers was comprehensively reviewed. Firstly, the structure and preparation method of MoS2 were introduced, and its applicable characteristics in the field of biosensors were explored. Secondly, we comprehensively reviewed the recent construction and application of sensing platform based on MoS2 in the field of cancer biomarkers detection in both electrochemical and optical aspects. The prime characteristics and application performances of MoS2 and its composites were emphasized. Additionally, we also involved some other types of biosensors based on MoS2. Finally, we summarized the challenges and development prospects of MoS2 in the application of cancer biomarkers detection, and provided some insights for the application potential of this kind of emerging nano-materials in a broader field.

We consider a coded compressed sensing protocol for unsourced massive random access (URA) that concatenates a shared Patterned Reed-Muller (PRM) inner codebook to an outer error-correction code. In this paper, an iterative list PRM projection algorithm is proposed to supplant the signal detector associated with the inner PRM sequences. In particular, we first propose an enhanced paths-saving algorithm called list PRM projection detection for the single-user scenario that keeps multiple candidates for the first few layers to remedy the risk of spreading errors. On this basis, we further propose an iterative list PRM projection algorithm for the multi-user scenario. The vectors for PRM codes and channel coefficients are jointly detected in an iterative manner, which offers significant improvements regarding the convergence rate for signal recovery. Furthermore, the performances of the proposed algorithms are analyzed mathematically, and we verified that the theoretical simulations are consistent with the numerical simulations. Finally, we concatenate the inner PRM codes that employ the iterative list detection to two practical error-correction outer codes. According to the simulation results, we conclude that the packetized URA with the proposed iterative list projection detection works better than benchmarks in terms of the number of active users it can support in each slot and the amount of energy needed per bit to meet an expected error probability.

Ditching-rotary tiller was widely used in tillage and ditching furrow during rapeseed sowing. As its ditching furrow system (consist of four identical ditching plows) would bear great drag resistance from the soil during operation, the ditching plow was optimized based on differential geometry analysis and EDEM simulation. Resistance-velocity simulation indicated the plow with parabolic type guide curve had better reduce-drag characteristics. Differential geometry analysis indicated decay rate of E and growth rate of G could represent the variable regularity of drag resistance with the increase of velocity. The L value could represent the magnitude of drag resistance. The smaller L value, decay rate of E and growth rate of G, the better drag-reduce characteristics. Quadratic rotation orthogonal combination design shown the optimal structural parameter values were: Δθ=15°, θmin=45°, h=250mm, l=100mm. The minimum average drag resistance was 230.1N. The differential geometry analysis of optimal ditching plow shown |dE/dκ| and |dG/dκ| could obtain minimum value, indicating growth rate of drag resistance for optimal plow was the lowest within the experimental level. Field experiment indicated the operation effect of optimized ditching furrow system could met the requirements of rapeseed sowing. The research provided in-depth theoretical guidance for Drag-reduce design of plow.

A self-consistent charge density-functional tight-binding method combined with molecular dynamics simulations is employed to reveal the effect of polymorph on the thermal decomposition stability of 1,1-Diamino-2,2-Dinitroethylene (FOX-7). Two types of heating, constant temperature heating and temperature-programmed heating, are adopted. Potential evolution indicates that γ-FOX-7 possesses the lowest thermal stability, as it is closer to the decomposition state. Crystal form has an important influence on the thermal decomposition of FOX-7, resulting in different decomposition rates and initial reactions. In general, β- and γ-FOX-7 always decompose more completely than α-FOX-7. This work emphases the importance of polymorph dependent initial decay of an energetic polymorphic compound once heated in a volume constrained condition.

Modified aluminum slag (MAS) was applied as an adsorbent for Congo red (CR) prepared by the hydrothermal treatment of Ca (OH) 2. At 25 ℃, with a MAS dosage of 0.3g, initial CR concentration of 100 mg/L and initial pH=5, and the adsorption time was 40 min, the CR removal efficiency was 98.41%. The adsorption trend of CR conformed to the second-order kinetics, and the adsorption isotherm follows the Freundlich isotherm model. Compared with RAS, MAS has a larger pore volume and specific surface area. The mechanism of action of MAS on CR was the interaction between membrane diffusion and internal diffusion, and the adsorption rate during the membrane diffusion was the fastest.

With the rapid development of urbanization, the chemical evolution of groundwater is significantly affected by human activities. However, the driving mechanisms of groundwater chemical evolution at different stages of urbanization remain unclear, severely impacting the implementation of groundwater protection. This study investigated the driving mechanisms of groundwater chemical evolution based on the long-term series (from 1985 to 2015) of hydrochemical data from 19 groundwater monitoring sites in rapidly urbanizing areas (Shijiazhuang, Hebei Province, China). The results show that the concentrations of various chemical components in groundwater gradually increase with the acceleration of urbanization process, especially NO3-, which has increased from 13.7 mg/L in the primary stage of urbanization (PSU) to 65.1mg/L in the advanced stage of urbanization (ASU), exceeding the WHO drinking water standard (50mg/L), indicating that the groundwater chemistry has been significantly affected by human activities. It is interesting to find that the main hydrochemical types have changed from HCO3•SO4-Ca•Mg type water in the PSU to SO4•HCO3-Ca•Mg type water in the ASU. It is worth noting that there were obvious differences in driving factors of groundwater chemical evolution at different urbanization stages. In the PSU, the driving factors of groundwater chemical evolution were carbonate and rock salt dissolution, cation exchange, and industrial activities. However, in the intermediate stage and advanced stage, the driving factors of groundwater chemical evolution were changed to carbonate and gypsum dissolution, groundwater over-exploitation, agricultural fertilization, and domestic sewage. Based on the above conclusions, it is suggested that future groundwater management should control the amount of agricultural fertilizers, apply scientific fertilization, and prohibit the discharge of various types of non-compliant sewage, while strengthening the supervision of groundwater extraction to reduce the impact of urbanization development on the groundwater chemical evolution process.

Detecting human head movement during sleep is important as it can help doctor to access some physical or mental health problems like infantile eczema, calcium deficiency, insomnia, anxiety disorder and even Parkinson’s disease, and provide useful clues for scientific diagnosing. To obtain the information of sleep head movement, current solutions either use the camera or require the user to wear intrusive sensors to collect the image or motion data. However, the vision-based schemes depend on the environmental light conditions and also bring privacy concerns. Some people including the elderly and infant may be reluctant to wear wearable devices during sleep. In this paper, we propose a novel system called Wi-Senser to address the issues mentioned above. Our Wi-Senser directly reuses the existing WiFi infrastructure and exploits the fine-grained channel state information (CSI) of WiFi signals to capture the minute human head movement during sleep without attaching any sensors to the human body. We design and implement our system with just one commercial off-the-shelf (COTS) router and one laptop equipped with Intel 5300 network interface card (NIC). We evaluate the performance of Wi-Senser with 6 volunteers (4 adults and 2 children). Extensive experiments demonstrate that Wi-Senser can achieve a 98.5% accuracy for head movement detection during sleep. Wi-Senser provides a new solution for achieving noninvasive, continuous and accurate human minute movement detection without any additional cost.

Microbial communities inhabiting the human body play a crucial role in protecting the host against pathogens and inflammation. Disruptions to the microbial composition can lead to various health issues. Microbial transfer therapy (MTT) has emerged as a potential treatment option to address such issues. Fecal microbiota transplantation (FMT) is the most widely used form of MTT and has been successful in treating several diseases. Another form of MTT is vaginal microbiota transplantation (VMT), which involves transferring vaginal microbiota from a healthy female donor to a diseased patient's vaginal cavity with the goal of restoring normal vaginal microbial composition. However, VMT has not been extensively studied due to safety concerns and a lack of research. This paper explores the therapeutic mechanisms of VMT and discusses future perspectives. Further research is necessary to advance the clinical applications and techniques of VMT.

Abstract: Self-regulated Learning has become one of educational psychology's most critical research areas. Contemporary research indicates that student creativity is crucial to the success of arts education. However, there is limited research on creativity in arts education in Self-regulated Learning. Therefore, this study aims to define the creativity characteristics that determine the quality of students’ work. This study implemented a creative competition in painting and composition for first-year undergraduates. It evaluated the characteristics of creativity during the three main phases of the task: planning, execution, and completion. We discovered through semi-open questionnaires (n=178)，and using the content analysis method. According to the competition results, the students with the highest scores in Flow, Inspiration, and Idea Generation in the Performance phase had the best quality work. In the Forethought phase, Analogical Thinking and Idea Generation worked best for most students, while in the Performance phase, Flow Sense, Idea Generation, and Idea Manipulation worked best.Data on creativity characteristics at different work phases and final quality might adequately guide and organize educational procedures. These findings can serve as a theoretical foundation for quantifying the creativity phase in Self-regulated Learning and offer arts educators a reference for creativity instruction.

Unsmooth reversing is one of the most common faults in the four-way reversing valve of air conditioning system, and the airflow in the valve chamber and the shape of the slider of the reversing valve are the main factors in unsmooth reversing. In order to study the influence of the airflow in the chamber and the slider shape on the reversing process, the fluid flow in the valve chamber of a four-way reversing valve is obtained using computational fluid dynamics (CFD) simulations, and the influence of slider structure on slider thrust and resistance of the four-way reversing valve is analyzed. Four-way reversing valves with no-cutting, straight-cutting and arc-cutting sliders are employed to evaluate the reversing characteristics. A pressure measuring device for a four-way reversing valve chamber is designed, which is performed to test the chamber pressure of three different types of sliders of four-way reversing valves. The maximum error of experimental tests and simulations is within 5% of engineering tolerance, so as to verify the reliability of numerical simulation. The results indicate that the chamber pressure and resistance-thrust ratio with the cutting slider are reduced, which is beneficial to the reversing of the four-way reversing valve. Compared with the straight cutting structure, the arc cutting slider four-way reversing valve has a more stable reversing process and better comprehensive reversing performance. The results can provide a theoretical basis for engineers to improve the performance of four-way reversing valves.

To improve the interfacial compatibility between cement matrix and expanded polystyrene (EPS) in the core-shell lightweight aggregates (CSLA), the effects of sodium silicate, Polyvinyl alcohol (PVA) emulsion, Vinyl acetate-ethylene (VAE) emulsion, acrylic acid, and acetic acid on the cement-EPS interface were investigated. The denseness of the interface was studied by scanning electron microscopy (SEM), and the effect of interfacial agents on the hydration process of cement was studied by the heat of hydration and induction resistivity. The macroscopic properties of the interface of the CSLA were characterized by the "leak-white" rate, drop resistance and numerical crushing strength. The results show that the sodium silicate densifies the interface by generating hydration products on the EPS surface. At the same time, organic acid enhances the interfacial properties of EPS and cement by increasing the surface roughness and allowing hydration products to grow in the surface micropores. In terms of the cement hydration process, both two interfacial agents delay the cement hydration. Above all, with comprehensive interface properties, "leak-white" rate, and mechanical properties, VAE emulsion and sodium silicate can achieve the best performance with a final crushing resistance of 5.7 MPa.

Large language model (LLM) is a representation of a major advancement in AI, and has been used in multiple natural language processing tasks. Nevertheless, in different business scenarios, LLM requires fine-tuning by engineers to achieve satisfactory performance, and the cost of achieving target performance and fine-tuning may not match. Based on the Baidu STI dataset, we study the upper bound of the performance that classical information retrieval methods can achieve under a specific business, and compare it with the cost and performance of the participating team based on LLM. This paper gives an insight into the potential of classical computational linguistics algorithms, and which can help decision-makers make reasonable choices for LLM and low-cost methods in business R&D.

Mobile Mapping System (MMS) plays a crucial role in generating high-precision 3D maps for various applications. However, the traditional MMS that uses tilted LiDAR (light detection and ranging) has limitations in capturing complete information of the environment. To overcome these limitations, we propose a panoramic vision-aided Cartographer simultaneous localization and mapping (SLAM) system for MMS, named "PVL-Cartographer". The proposed system integrates multiple sensors to achieve accurate and robust localization and mapping. It contains two sub-systems, early fusion and middle fusion. In the early fusion, range-maps are created from LiDAR points in a panoramic image space, facilitating the incorporation of visual features. The SLAM system works with both visual features with and without augmented ranges. In the middle fusion, a pose graph combines camera and LiDAR nodes, with IMU (Inertial Measurement Unit) data providing constraints between each node. Extensive experiments in challenging outdoor scenarios demonstrate the effectiveness of the proposed SLAM system in producing accurate results, even in conditions with limited features. Overall, our proposed PVL Cartographer system offers a robust and accurate solution for MMS localization and mapping.

Recently, a layer-stacked ESN model named deep echo state Network (DeepESN) has been established. As an interactional model of recurrent neural network and deep neural network, investigations of DeepESN are of significant importance in both areas. Optimizing the structure of neural networks remains a common task in artificial neural networks, and the question of how many neurons should be used in each layer of DeepESN must be stressed. In this paper, our aim is to solve the problem of choosing the optimized size of DeepESN. Inspired by the sensitive iterative pruning algorithm, a neuronal similarity-based iterative pruning merging algorithm (NS-IPMA) is proposed to iteratively prune or merge the most similar neurons in DeepESN. Two chaotic time series prediction tasks are applied to demonstrate the effectiveness of NS-IPMA. The results show that the DeepESN pruned by NS-IPMA outperforms unpruned DeepESN with the same network size, and NS-IPMA is a feasible and superior approach to improving the generalization performance of DeepESN.

While the language model using the stop sign as an independent token has been widely used to decide when the model should stop, it may lead to the growth of vocabulary dimensions and further problems. Similarly, present research on game algorithms usually estimate stopping point related problems based on the evaluation of the winning rate. However, information redundancy may also exist in such models, thus increasing the training difficulty. Above two types of tasks (and similar autoregressive tasks) show a common problem of stopping point prediction. In this paper, we describe a design of separated model, trying to separate the complexity of stopping point prediction from the main task model, so that the information used for estimating stopping point can be reduced. On this basis, in order to verify the rationality of using separated model, we propose a model-free test method. It judges the separability of transformed data based on point difference and sequence difference metrics. In this way, it can predict the credibility of the separated model inference.

Based on data from the Yunnan Province farm household survey, we examine the effect of rural land rights policy on farmers’ income. The regression results show that right significantly raises the total income of farmers, with farm income serving as the primary source of total income. After performing numerous robustness tests, using instrumental variables to handle endogeneity and arriving at the same conclusion, the result is still valid. According to the heterogeneity analysis, in the sample of households with long-term migrant workers, the confirmation of rural land rights significantly increases total and nonfarm income while decreasing farm income. Furthermore, total income includes nonfarm income, which reflects the effect of different farmers' optimal labor allocation based on the external market environment. According to the impact mechanism anal-ysis, right can increase farmers' total income by promoting land transfer, and farmers in less developed areas are more willing to increase their income by land transfer out.

In this paper, industrial structure distortion, two-way FDI and carbon emission intensity are brought into a unified research framework, and based on China's panel data from 2011 to 2020, empirical tests are conducted employing Exploratory Spatial Data Analysis (ESDA), spatial econometric model and intermediary effect test. The results show the following. Firstly, China's industrial structure distortion index shows a downward trend. The industrial structure distortion index is the highest in the west, followed by the middle, and the lowest in the East. Secondly, the relationship between carbon emission intensity and economic development shows a "decoupling" effect and keeps decreasing year by year. The spatial disparity is remarkable, showing the pattern of "the east leading, the middle catching up and the west lagging ". At the provincial level, except in Xinjiang province, the carbon emission intensity of other provinces showed different degrees of decline. In terms of spatial distribution, the polarization characteristics of carbon emission intensity are significant, and the traditional spatial distribution pattern has been broken. Thirdly, there is a positive spatial correlation between China's industrial structure distortion, two-way FDI and carbon emission intensity. The distortion of industrial structure will not only lead to the increase of local carbon emission intensity but also produce reverse spillover to adjacent areas. IFDI and OFDI provide a strong driving force for the decline of carbon emission intensity. IFDI promotes the decline of carbon emission intensity in adjacent areas, while OFDI will increase the carbon emission intensity in surrounding areas. The interaction of IFDI and OFDI can significantly reduce the carbon emission intensity of local and adjacent areas. Fourthly, the results of intermediary effect analysis show that two-way FDI is the two channels of industrial structure distortion affecting carbon emission intensity. Industrial structure distortion can affect the transmission mechanism of carbon emission intensity by affecting two-way FDI.

As a representative of Exponential Organizations, MI went from obscurity to the Fortune 500 in just ten years. Mi's success is inextricably linked to its outstanding business model. This paper summarizes the elements of MI's business model from four perspectives: value proposition, value creation, value delivery, and value capture, as well as its measures for developing into an exponential organization. Expecting to provide theoretical references for the transformation and upgrading of manufacturing organizations.

Spatial crowdsourcing emerges as a new computing paradigm that enables mobile users to accomplish spatio- temporal tasks in order to solve human-intrinsic problems. Existing crowdsourcing systems critically use centralized servers for interacting with workers and making task assignment decisions. These systems are hence susceptible to issues such as the single point of failure and the lack of operational transparency. Prior work, therefore, turns to blockchain-based decentralized crowdsourcing systems, yet still suffers from problems of lacking efficient task assignment scheme, requiring a deposit to an untrusted system, low block generation speed, and high transaction fees. To address these issues, we design a blockchain-based decentralized framework for spatial crowdsourcing, which we call SC-EOS. Our system does not rely on any trusted servers, while providing efficient and user-customizable task assignment, low monetary cost, and fast block generation. More importantly, it frees users from making a deposit into an untrusted system. Our framework can also be extended and applied to generic crowdsourcing systems. We implemented the proposed system on the EOS blockchain. Trace-driven evaluations involving real users show that our system attains the comparable task assignment performance against a clairvoyant scheme. It also achieves 10× cost savings than an Ethereum-based implementation.

Alfalfa (Medicago sativa L.) is the most cultivated forage legume around the world. Under a variety of growing conditions, forage yield in alfalfa is stymied by biotic and abiotic stresses including heat, salt, drought, and disease. Given the sessile nature of plants, they use strategies such as differential gene expression to respond to environmental cues. Transcription factors control the expression of genes that contribute to or enable tolerance and survival during periods of stress. Basic-leucine zipper (bZIP) transcription factors have been demonstrated to play a critical role in regulating plant growth and development as well as mediate the responses to abiotic stress in several species, including Arabidopsis thaliana, Oryza sativa, Lotus japonicus, and Medicago truncatula. However, there is little information about bZIP transcription factors in cultivated alfalfa. In the present study, 237 bZIP genes were identified in alfalfa from publicly available sequencing data. Multiple sequence alignments showed the presence of intact bZIP motifs in the identified sequences. Based on previous phylogenetic analyses in Arabidopsis thaliana, alfalfa bZIPs were similarly divided and fell into 10 groups. The physicochemical properties, motif analysis, and phylogenetic study of the alfalfa bZIPs revealed high specificity within groups. The differential expression of alfalfa bZIPs in a suite of tissues indicates that particular bZIP genes are specifically expressed at different developmental stages in alfalfa. Similarly, expression analysis in response to ABA, cold, drought, and salt stresses, indicates that a subset of bZIP genes are also differentially expressed and likely play a role in abiotic stress signaling and/or tolerance. These expression patterns were further verified by qRT-PCR. However, further functional characterization of bZIP transcription factors in alfalfa will help illuminate the role they play in stress tolerance mechanisms in legumes and facilitate the molecular breeding of stress tolerance in alfalfa.

In the aim of improving the positioning accuracy of monocular visual inertial simultaneous localization and mapping (VI-SLAM) system, an improved initialization method with faster convergence is proposed. This approach is classified as three parts: Firstly, in the initial stage, the pure vision measurement model of ORB-SLAM is employed to make all the variables visible. Secondly, the frequency of IMU camera was aligned by IMU preintegration technology. Thirdly, an improved iterative method is put forward for estimating the initial parameters of IMU faster. The estimation of IMU initial parameters is divided into several simpler sub-problems, containing direction refinement gravity estimation, gyroscope deviation estimation, accelerometer bias and scale estimation. The experimental results on the self-built robot platform show that our method can up-regulate the initialization convergence speed, simultaneously improve the positioning accuracy of the entire VI-SLAM system.

Speech emotion recognition remains a heavy lifting in natural language processing. It has strict requirements to the effectiveness of feature extraction and that of acoustic model. With that in mind, a Heterogeneous Parallel Convolution Bi-LSTM model is proposed to address these challenges. It consists of two heterogeneous branches: the left one contains two dense layers and a Bi-LSTM layer, while the right one contains a dense layer, a convolution layer, and a Bi-LSTM layer. It can exploit the spatiotemporal information more effectively, and achieves 84.65%, 79.67%, and 56.50% unweighted average recall on the benchmark databases EMODB, CASIA, and SAVEE, respectively. Compared with the previous research results, the proposed model achieves better performance stably.

While the long-term effects of COVID-19 are yet to be determined, its immediate impact on crowdfunding is nonetheless significant. This study takes a computational approach to more deeply comprehend this change. Using a unique data set of all the campaigns published over the past two years on GoFundMe, we explore the factors that have led to the successful funding of a crowdfunding project. In particular, we study a corpus of crowdfunded projects, analyzing cover images and other variables commonly present on crowdfunding sites. Furthermore, we construct a classifier and a regression model to assess the significance of features based on XGBoost. In addition, we employ counterfactual analysis to investigate the causality between features and the success of crowdfunding. More importantly, sentiment analysis and the paired sample t-test are performed to examine the differences in crowdfunding campaigns before and after the COVID-19 outbreak that started in March 2020. First, we note that there is significant racial disparity in crowdfunding success. Second, we find that sad emotion expressed through the campaign's description became significant after the COVID-19 outbreak. Considering all these factors, our findings shed light on the impact of COVID-19 on crowdfunding campaigns.

Surface soil moisture (SSM) is a significant factor affecting crop growth. This paper presents a method for retrieving SSM over wheat-covered areas using synergy dual-polarization C-band Sentinel-1 synthetic aperture radar and Sentinel-2 optical data. Firstly, a modified water cloud model (WCM) was proposed to remove the influence of vegetation from the backscattering coefficient of the radar data. The vegetation fraction was then introduced in this WCM, and the vegetation water content (VWC) was calculated using multiple linear regression model. Subsequently, the support vector regression technique was used to retrieve the SSM. This approach was validated using in-situ measurements of the wheat field in Hebi, in the north of Henan Province. The key findings of this study are as follows: (1) Based on vegetation indices obtained from Sentinel-2; the proposed VWC estimation model can effectively eliminate the influence of vegetation; (2) compared with vertical transmit and horizontal receive polarization, vertical transmit and vertical receive polarization is better for detecting changes in SSM at different growth stages of wheat; and, (3) the validation results indicated that the proposed approach, based on Sentinel-1 and Sentinel-2 data, successfully retrieved SSM in the study area.

Revealing the binding properties of calcium ion (Ca2+) and magnesium ion (Mg2+) to chromophoric dissolved organic matter (CDOM) facilities understanding the effect of natural water composition on the photophysics of dissolved organic matter. Steady-state and time-resolved fluorescence spectrometry, and dynamic light scattering were applied to investigate the fluorescence quenching process of CODM by Ca2+ and Mg2+. The binding of Ca2+ and Mg2+ preferred terrestrial CDOM to aquatic CDOM. The fluorescence quenching of CDOM by cations mainly occurred in a static process, which was based on the fact that the decrease of steady-state fluorescence intensity was greater than fluorescence lifetime. The fluorescence quenching was profound under longer excitation and emission wavelength. The binding constant (K, L/mol) for Ca2+ to CDOM from terrestrial source ranged from 4.29 to 5.09 (lgK), which was approximately one order of magnitude higher than that of Mg2+ to CDOM (3.86 to 4.56). Fluorescence decay became faster in the presence of Ca2+ and Mg2+. Lifetime distribution of CDOM excited states shifted to small value side in the presence of metal ions, particularly for Ca2+, indicating fluorescence quenching of CDOM mainly through the interaction of Ca2+/Mg2+ with relatively long-lived fluorophores.

A fundamental question in biology is how cell shapes are genetically encoded and enzymatically generated. Prevalent shapes among walled bacteria include spheres and rods. These shapes are chiefly determined by the peptidoglycan (PG) cell wall. Bacterial division results in two daughter cells, whose shapes are predetermined by the mother. This makes it difficult to explore the origin of cell shapes in healthy bacteria. In this review, we argue that the Gram-negative bacterium Myxococcus xanthus is an ideal model for understanding PG assembly and bacterial morphogenesis because it forms rods and spheres at different life stages. Rod-shaped vegetative cells of M. xanthus can thoroughly degrade their PG and form spherical spores. As these spores germinate, cells rebuild their PG and reestablish rod shape without preexisting templates. Such a unique sphere-to-rod transition provides a rare opportunity to visualize de novo PG assembly and rod-like morphogenesis in a well-established model organism.

We report enhanced nonlinear optics in complementary metal-oxide-semiconductor (CMOS) compatible photonic platforms through the use of layered two-dimensional (2D) graphene oxide (GO) films. We integrate GO films with silicon-on-insulator nanowires (SOI), high index doped silica glass (Hydex) and silicon nitride (SiN) waveguides and ring resonators, to demonstrate an enhanced optical nonlinearity including Kerr nonlinearity and four-wave mixing (FWM). The GO films are integrated using a large-area, transfer-free, layer-by-layer method while the film placement and size are controlled by photolithography. In SOI nanowires we observe a dramatic enhancement in both the Kerr nonlinearity and nonlinear figure of merit (FOM) due to the highly nonlinear GO films. Self-phase modulation (SPM) measurements show significant spectral broadening enhancement for SOI nanowires coated with patterned films of GO. The dependence of GO’s Kerr nonlinearity on layer number and pulse energy shows trends of the layered GO films from 2D to quasi bulk-like behavior. The nonlinear parameter of GO coated SOI nanowires is increased 16 folds, with the nonlinear FOM increasing over 20 times to FOM > 5. We also observe an improved FWM efficiency in SiN waveguides integrated with 2D layered GO films. FWM measurements for samples with different numbers of GO layers and at different pump powers are performed, achieving up to ≈7.3 dB conversion efficiency (CE) enhancement for a uniformly coated device with 1 layer of GO and ≈9.1 dB for a patterned device with 5 layers of GO. These results reveal the strong potential of GO films to improve the nonlinear optics of silicon, Hydex and SiN photonic devices.

The study aimed to estimate the prevalence and associated factors of cervical and breast cancer screening among women in the general population in Jordan. Nationally representative cross-sectional data were analysed from 14,689 women (34 years median age, range 15-49) that took part in the “2017-18 Jordan Population and Family Health Survey”. Information about cancer screening uptake included Pap smear, clinical breast examination, and mammography. Results indicate that the prevalence of ever Pap smear cancer screening was 15.3%, clinical breast examination in the past 12 months 13.9% and ever mammography 8.7%. In adjusted logistic regression analysis, older age, higher wealth, greater media exposure and tobacco use were positively and being Syrian, and living in the southern region were negatively associated with ever Pap smear, clinical breast examination in the past 12 months, and ever mammography. In addition, high decision-making power was associated with the uptake of Pap smear and higher education was associated with ever mammography. The study showed a low cancer screening uptake, and several factors were identified that can assist in promoting cancer screening in Jordan.

Quantum noise limits the sensitivity of laser interferometric gravitational-wave detectors. Given the state-of-the-art optics, the optical losses define the lower bound of best possible quantum-limited detector sensitivity. In this work, we come up with the configuration which allows to saturate this lower bound by converting the signal recycling cavity to be a broadband signal amplifier using an active optomechanical filter. We will show the difference and advantage of such a broadband signal recycling scheme compared with the previous white-light-cavity scheme using the optomechanical filter in [Phys.Rev.Lett.115.211104 (2015)]. The drawback is that the new scheme is more susceptible to the thermal noise of the mechanical oscillator. To suppress the radiation pressure noise which rises along with the signal amplification, squeezing with input/output filter cavities and heavier test mass are used in this work.

Separation and interpretation of rebellious Circulating Tumor Cells (CTCs) originating from the primary tumor or cancer tissue plays a significant role in diagnostics, cancer progression analyses, suitable medicine exploration, and treatment proficiency examination. Cancer metastasis occurs when CTCs spread throughout the body and invade healthy tissues, leading to new tumors in that area. Although a dramatic rate of deaths begins from spreading CTCs around the body, valuable measures have been made to control their development. However, the first step is separating these harmful cells from the bloodstream and investigating their features. Having examined the characteristics of CTCs as cancer’s main strength, researchers can introduce complementary treatments that can affect cancerous cells without damaging the healthy cells. Therefore, according to their unique characteristics, numerous techniques have been established for continuous and fast separation and sorting of CTCs. Nevertheless, few separators enjoy the efficient performance and appropriate accuracy and can be produced in mass numbers due to the available fabrication equipment. Microfabrication advancements enable separators to combine the advantages of active and passive methods in a small-scale platform for probing individual cells and separation purposes. Reduction in reagents, sample volume, analysis time, and less harmfulness to patients are some of the motivations that encourage researchers to employ microfluidic instruments for CTCs separation from other blood cells over the last two decades. However, microfabrication limitations mean effective separators, and the diagnostic option they provide, are not readily available. Addressing these limitations requires optimizing the design and fabrication of separators such that they are reduced in their size and fabrication cost, while also maintaining high-throughput separating capability. The emergence of the Lab-On-a-Chip (LOC) and then Lab-On-a-CD (LOCD) technologies, having more inherent benefits than conventional microfluidic devices, has created new opportunities and become increasingly widespread in recent years. Evidence suggests that employing single methodologies or integrating approaches without sufficient understanding of potential outcomes is unlikely to result in successful diagnostic results. This paper contributes an extensive review of several separation systems, including fundamental theories and experimental details, and describes detailed operating principles and device performance.

This paper presents a numerical algorithm for solving high-order BVPs. We introduce the construction method of multiscale orthonormal basis in W^m[0; 1] by multiscale orthonormal basis in W¹[0; 1]. We de fine approximate solution, and obtain the approximate solution of high-order BVPs by using the approximate theory. Moreover, the convergence and stability of the algorithm are improved. At last, several numerical experiments show the feasibility of the proposed method.

Deep learning has achieved remarkable success in diverse computer science applications, however, its use in other traditional engineering fields has emerged only recently. In this project, we solved several mechanics problems governed by differential equations, using physics informed neural networks (PINN). The PINN embeds the differential equations into the loss of the neural network using automatic differentiation. We present our developments in the context of solving two main classes of problems: data-driven solutions and data-driven discoveries, and we compare the results with either analytical solutions or numerical solutions using the finite element method. The remarkable achievements of the PINN model shown in this report suggest the bright prospect of the physics-informed surrogate models that are fully differentiable with respect to all input coordinates and free parameters. More broadly, this study shows that PINN provides an attractive alternative to solve traditional engineering problems.

Service pricing is a bottleneck in the development of innovation services, as it is the issue of most concern between the suppliers and demanders. In this paper, a negotiation pricing model that is based on the multiobjective genetic algorithm is developed for innovation service pricing. Regarding the service pricing process as a multiobjective problem, the objective functions, which include the service price, service efficiency, and service quality, for suppliers and demanders are constructed. As the solution of a multiobjective problem is typically a series of alternatives, another negotiation process is necessary for determining the final decision. A learning strategy is adopted during the negotiation process to simulate reality. Finally, the model is implemented for an innovation service transaction, the objective of which is to identify the optimal price plan. The results demonstrate that the model can provide quantitative decision support for the pricing of an innovation service and ultimately yield a win-win result for both the supplier and demander of the innovation service. Furthermore, the influence of the parameters during the negotiation process is analyzed in detail. The effects of the learning strategy on accelerating the negotiation process, as well as the chosen of reasonable parameters are given.

We prepared heterogeneous alumina-silicate glasses by consolidating nanoparticles using molecular dynamics simulations. Consolidated glasses from either low alumina content alumina-silicate glasses or high alumina content alumina-silicate glasses show significantly improved ductility around consolidation pressure of ~3 GPa. The introduced structural heterogeneities, namely over-coordinated network formers and their neighboring oxygen atoms, are identified as plasticity carriers due to their high rearrangement propensity. In addition, consolidated oxide glass from both 23.4Al₂O₃76.6SiO₂ and 73.1Al₂O₃26.9SiO₂ nanoparticles show improved flow strength (up to 1 GPa) due to the introduction of chemical heterogeneities. Last but not least, apparent hardening behavior appears upon cold work in consolidated glasses, with an increase of yield strength from ~3.3 GPa to ~6.4 GPa. This method is a big advancement toward ultra-strong and ultra-tough glasses by breaking the structure, composition and size limitations in traditional melt-quench process.

Flexibility of polymers defined by an equation in 2019 is related here to thermal conductivity, using reliable data for both properties found in the literature. The resulting equation is simple, it has the form of a quadratic polynomial. The goodness of the fit represented by R² = 0.975, while R² = 1 represents a perfect fit. Thus, knowledge of one of these properties can be used for calculation of the other one. The present results are a part of a larger program enabling obtaining by calculation pertinent properties of polymers from other properties for which data are available.

The purpose of this paper is twofold. First, we introduce a geometric approach to study the circular orbit of a particle in static and spherically symmetric spacetime based on Jacobi metric. Second, we apply the circular orbit to study the weak gravitational deflection of null and time-like particles based on Gauss-Bonnet theorem. By this way, we obtain an expression of deflection angle and extend the study of deflection angle to asymptotically non-flat black hole spacetimes. Some black holes as lens are considered such as a static and spherically symmetric black hole in the conformal Weyl gravity and a Schwarzschild-like black hole in bumblebee gravity. Our results are consistent with the previous literature. In particular, we find that the connection between Gaussian curvature and the radius of a circular orbit greatly simplifies the calculation.

Corona viruses hijack human enzymes to assembly sugar coat on Spike glycoproteins. The mechanism that human antibodies may uncover the antigenic viral peptide epitopes hidden by sugar coat are unknown. In this study, we analyzed recombinant SARS-CoV-2 Spike protein secreted from BTI-Tn-5B1-4 cells, by trypsin and chymotrypsin digestion followed by mass spectrometry analysis. We acquired MS/MS spectrums for glycopeptides of all 22 predicted N-glycosylated sites. We further analyzed the surface accessibility of Spike proteins according to Cryo-EM and homolog-modeled structures, and available antibodies that bind to SARS-CoV-1. The results showed that all 22 N-glycosylated sites of SARS-CoV-2 are modified by high-mannose type of N-glycans. MS/MS fragmentation clearly established the glycopeptide identities. Electron densities of glycans cover most of the Spike receptor binding domain of SARS-CoV-2, except YQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQ, similar to a region FSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQ in SARS-CoV-1. Other surface-exposed domains included those located on Central Helix, between amino acids 967 and 1016 of SARS-CoV-1, and 985 to 1034 of SARS-CoV-2 Spike protein. As the majority of antibody paratopes bind to peptide portion with or without sugar modification, we propose a snake-catcher model that a minimal length of peptide is first clamped by a paratope, and the binding is either strengthened by sugars close to peptide, or not interfered by sugar modification.

As an important research content in cultural geography, the exploration and analysis of the laws of regional cultural differences has great significance for the discovery of distinctive cultures, protection of regional cultures and in-depth understanding of cultural differences. In recent years, with the "spatial turn" of sociology, scholars are paying more and more attention to the implicit spatial information in social media data and the various social phenomena and laws they reflect. One important aspect is to grasp the social cultural phenomena and its spatial distribution characteristics through the text. Using machine learning methods such as the popular natural language processing (NLP), this paper can not only extract hotspot cultural elements from text data but also accurately detect the spatial interaction pattern of some specific cultures and the characteristics of emotions towards non-native cultures. Taking the 6,128 answers to the question “what are the differences between South and North China that you never know” on the Zhihu Q&A Platform as an example, with the help of NLP, this paper has explored the cultural differences between South and North China in people’s mind. This paper probes into people’s feeling and cognition of the cultural differences between South and North China from three aspects, including spatial interaction patterns of hotspot cultural elements, components of hotspot culture and emotional characteristics under the influence of cultural differences between North and South. The study reveals that 1) people from North and South China have great differences in recognizing each other’s culture. 2) Food culture is the most popular among many cultural differences. 3) People tend to show negative attitude towards the food cultures different from their own. All these findings shed light upon the understanding of regional cultural differences and addressing cultural conflicts. In addition, this paper also provides an effective solution to the study from a macro perspective, which have been difficult for new cultural geography.

The purpose of this study is to propose a consecutive manufacturing process system to secure the productivity of excellent STKN540B steel tube in the respect of economy and safety as the supporting material for mega structures such as building, bridge and ship. The components of consecutive manufacturing are press-bending, orbital auto welding and steel tube correction. By using STKN540B a high-strength steel material with low yield point that requires a special manufacturing process unlike other steel materials, an actual tube manufacturing is carried out at each stage in this experimental study. With this, the quality of steel tube and the efficiency of the manufacturing process are analyzed to draw out some points to improve in the future.

Bartonella henselae is a fastidious Gram-negative intracellular bacterium which can cause cat scratch disease, endocarditis in humans and animals as well as other complications, leading to acute or chronic infections. The current treatment for Bartonella infections is not very effective due to antibiotic resistance and also persistence. To develop better therapies for persistent and chronic Bartonella infections, in this study, with the help of SYBR Green I/PI viability assay, we performed a high-throughput screening of an essential oil library against stationary phase B. henselae. We successfully identified 32 essential oils that had high activity, including four essential oils extracted from Citrus plants, three from Origanum, three from Cinnamomum, two from Pelargonium and two from Melaleuca, as well as frankincense, ylang ylang, fir needle, mountain savory (winter), citronella, spearmint, elemi, vetiver, clove bud, allspice and cedarwood essential oils. The minimal inhibitory concentration (MIC) determination of these 32 top hits indicated they were not only active against stationary phase non-growing B. henselae but also had good activity against log phase growing B. henselae. The time-kill curve by drug exposure assay showed 13 active hits, including essential oils of oregano, cinnamon bark, mountain savory (winter), cinnamon leaf, geranium, clove bud, allspice, geranium bourbon, ylang ylang, citronella, elemi and vetiver, could eradicate all stationary phase B. henselae cells within 7 days at the concentration of 0.032% (v/v). Two active ingredients, carvacrol and cinnamaldehyde, of oregano and cinnamon bark essential oils, respectively, were shown to be very active against stationary phase B. henselae such that they were able to eradicate all the bacterial cells even at the concentration ≤ 0.01% (v/v). Our finding of active essential oils may help to develop more effective treatments for persistent Bartonella infections.

The remediation of dredged marine sediments contaminated by heavy metals has drawn increasing attention worldly. The immobilization was regarded as a promising method to reduce adverse impacts on marine ecosystem. In this study, kaolinite and limestone were used as amendments to immobilize heavy metals (e.g. Zn, Pb and Cu) respectively in dredged marine sediments collected from the coastal zone adjacent to Tianjin Port in Bohai Bay. The sequential extraction procedure was applied to identify the mobility of heavy metals and further to evaluate the immobilization effect of amendments. The physical-chemical properties of sediments, such as pH, electrical conductivity (EC), salinity, and total organic carbon (TOC), were also measured to better understand their influence on heavy metals’ mobility. In addition, the compositions of clay minerals were also analyzed to identify the transformation process of minerals in the sediments. The results of sequential extraction procedure indicated that mobile fractions of heavy metals were converted into relatively stable fractions because of the two amendments. In addition, EC, salinity and TOC decreased moderately while no obvious variations of pH in the sediments were observed with the addition of the the kaolinite and the limestone. The percentage of montmorillonite decreased to minimum value while that of chlorite increased gradually during the experimental periods for 40 days probably due to complexation reaction. It was confirmed that both kaolinite and limestone can effectively reduce the mobility and bioavailability of heavy metals, particularly for Zn, generally, limestone has a better immobilization effect compared with kaolinite.

We propose a computer-generated hologram method for near-eye virtual reality and augmented reality 3D display. A 3D object located near the holographic plane is projected onto a projection plane to obtain a plurality of projected images with different angles. The hologram is calculated by superposition of projected image convolution with a specific PSF through the interference of reference wave with object wave. Holographic 3D display systems with LED as illumination, 4f optical filtering system and lens as eyepiece for near-eye VR display and HOE as combiner for near-eye AR display are designed. The results show that the proposed method is about 38 times faster than the conventional point cloud method. The proposed method is flexible to produce speckle noise free high-quality VR and AR images with efficient focus and defocus capabilities.

Targeted enrichment of ultraconserved elements (UCE) has emerged as a promising tool for inferring evolutionary history in many taxa, with utility ranging from phylogenetic and phylogeographic questions at deep time scales to population level studies at shallow time scales. However, the methodology can be daunting for beginners. Our goal is to introduce UCE phylogenomics to a wider audience by summarizing recent advances in arthropod research, and to familiarize readers with background theory and steps involved. We define terminology used in association with the UCE approach, evaluate current laboratory and bioinformatic methods and limitations, and, finally, provide a roadmap of steps in the UCE pipeline to assist phylogeneticists in making informed decisions as they employ this powerful tool. By facilitating increased adoption of UCE in phylogenomics studies that deepen our comprehension of the function of these markers across widely divergent taxa, we aim to ultimately improve understanding of the arthropod tree of life.

Surface urban heat island (SUHI) depicts the deteriorating thermal environment in high-density cities and local climate zone (LCZ) classification provides a universal protocol for SUHI identification. In this study, taking the central urbanized area of Guangzhou in the humid subtropical region of China as the study area, the maps or images of LCZ, land surface temperature (LST), SUHI and urban design factors were achieved by using Landsat satellite data, GIS database and a series of retrieval and classification algorithms, and the urban design factors influencing SUHI were investigated based on 625 samples of LCZs. The results show that in the summer daytime under the clear sky condition, the LST varied greatly from 26 °C to 40 °C and the SUHI changed in a wide range of -6 °C to 8 °C in the LCZs of the study area. Seven and five urban design factors influencing the summer daytime SUHI were identified for the two dominant LCZ of LCZs 1-5 (LCZ 1 to LCZ 5) and the mixed LCZ (containing at least three types of LCZs), respectively. The summer daytime SUHI prediction models were obtained by using the step-wise multiple linear regression, with the performance of R2 of 0.697, RMSE of 1.21 °C, and the d value of 0.81 for the model of LCZs 1-5, and the values of 0.666, 1.66 °C, and 0.76 for the model of the mixed LCZ, indicating that the models can predict the changes of SUHI with LCZs to a large and satisfactory extent. This study presents a methodology to efficiently achieve a large sample of SUHI and urban design factors of LCZs in the largely urbanized cities, and provides information beneficial to the urban designs and regenerations in the humid subtropical region.

After World War II, the economic recovery of Western Europe implied a swift economic transition for all regions, including the area of the Alps, although affecting various parts at different pace and stages. The resulting out-migration led to population decline in some mountain valleys and regions already since the 1950s. A similar out-migration movement began in China after its rural reform started in the 1970s. The effect was in some cases even more significant than in the Alps, with the first village being deserted in the 1980s. Current estimations report of about 380,000 abandoned rural villages in China between 2000 and 2016, particularly in its mountain regions. While lower population densities might alleviate the pressures on ecology and contribute to environmental benefits, these movements aggravate a spiraling-down process of local economies and culture. In the Alps many regions facing challenges of out-migration and economic changes elaborated agritourism schemes that provided both economic incentives and stability to involved mountain farmers, and continuation of local land management systems. In contrast, in China hardly any comparable trends of rural tourism developed. However, in recent years China's interest for tourism-oriented farm diversification increased and a range of rural tourism and agricultural tourism initiatives emerged. This paper focuses on the analysis of successful initiatives, problems and development prospects in the Alps and China's rural areas, redefining agritourism as a systematic integrated activity. Agritourism might therefore be assessed as a core element of the future sustainable development of the Alps and the Chinese countryside.

The many-body problem in quantum physics originates from the difficulty of describing the non-trivial correlations encoded in the exponential complexity of the many-body wave function. Motivated by the Giuseppe Carleo's work titled solving the quantum many-body problem with artificial neural networks [Science, 2017, 355: 602], we focus on finding the NNQS approximation of the unknown ground state of a given Hamiltonian $H$ in terms of the best relative error and explore the influences of sum, tensor product, local unitary of Hamiltonians on the best relative error. Besides, we illustrate our method with some examples.

Synthesis of poly(o-phenylenediamine) (PoPD) and poly(o-phenylenediamine)-ZnO (PoPD-ZnO) nanocomposites on carbon steel by in-situ polymerization with HCl acid as doping acid Material coating. The composition and structure of PoPD-ZnO nanocomposites were characterized by Fourier transform infrared spectroscopy (FTIR), X-ray diffraction (XRD) and scanning electron microscopy (SEM). The corrosion protection ability of polymer coatings in 3.5% NaCl was studied by potentiodynamic polarization curves and electrochemical impedance spectroscopy. It can be seen from the electrochemical corrosion experimental data that PoPD-WPU coating (PWC) and PoPD-ZnO-WPU coating (PZWC) can effectively improve the corrosion resistance of the carbon steel substrate, and the corrosion rate is reduced by 2-3 orders of magnitude compared with carbon steel. The conclusion demontrates that PoPD can effectively extend the service life of carbon steel substrates. In addition, it is advantageous to form a compact and low-defect coating when added nano-particle ZnO, which is advantageous for the POPD film to develop its good barrier property and corrosion resistance.

The species and bio-availability of phosphorus (P) in primary, secondary and digested sludge were fractionated and further analyzed in this study. Results showed that inorganic P (IP) was the primary P fraction in the secondary sludge and digested sludge, in which non-apatite IP (NAIP) amounted to 91.6% and 69.3% of IP, respectively. Organic P (OP), accounting for about 71.7% of total P (TP), was the dominant P composition in primary sludge. The content of bio-available P was about 9.7, 43.4, 29.8 mg-P/g-TS in primary sludge, secondary sludge and digested sludge, respectively, suggesting secondary sludge is the optimal choice when land application of sewage sludge is taken into consideration, followed by digested sludge and primary sludge. Polyphosphate and orthophosphate, comprising approximately 54.3% and 89.2% of TP, was the dominant P species in the secondary sludge and digested sludge, respectively. Monoester-P (54.6% of TP in extract) and diester- P (24.1%) were identified as OP species in primary sludge by Phosphorus-31 nuclear magnetic resonance (31PNMR). The present results would be helpful for P recovery and recycle from sewage sludge in wastewater treatment plant.

The world is facing several global issues such as food and energy crisis, climate change and greenhouse gases emissions. To subdue these issues, many entities from academia and industries have innovated alternate techniques of performing regular activities which cause such problems. One of these innovations is the introduction of vertical and zero acreage farming in the field of sustainability. These carry the potential to solve one of the most important affairs of food security in most countries of the world. But, this technology has been in its nascent stage for many years. This paper uses a comprehensive framework proving the feasibility of initiating vertical farming on university campuses to feed the staff and students, which could also set an example to the rest of the world into using this technique on a wider scale. The study chose Huazhong University of science and technology (HUST) in Wuhan city, China for accessing the return on investment and food sufficiency if vertical farming is implemented. Using Central Limit Theorem, a statistical model was developed, and various scenarios were analyzed. The results indicated that if a separate vertical farm is constructed, the breakeven can be achieved in a range of 10-20 depending on parameters such as type of operation, number of floors and amount of vegetation. The study has shown that the use of vertical farming cannot only bring in revenue for the campus but also aid in mitigating climate change.

Automobile proving ground is important for the research of vehicles which is used for the vehicle dynamics, durability testing, braking testing, etc. However, the roads in automobile proving ground will inevitably be damaged with the extension of the service life. In most previous researches, equipment similar to laser cross-section was used to detect pavement quality, the principle of which was to reflect pavement quality by detecting road surface roughness. This method ignores the elastic deformation of the roads itself when the vehicle is traveling on it and hardly compensate for the amendment. Therefore, this article presents a new method based on force sensor to reduce the impact of elastic deformation such as wheel tyre deformation, pavement deformation, and wheel rim deformation. In which, force sensors mounted on the wheels collect the three-dimensional dynamic load of the wheel.The presented method has been tested with two sets of cobblestone road load data, and the results show that The　incentives imposed by the test vehicle on the target road are 88.3%, 91.0%, and 92.05% of the incentives imposed by the test vehicle on the standard road in three dimensions, respectively. It is clear that the proposed method has strong potential effectiveness to be applied for lose detection of the special road application.

Automated Electrocardiogram (ECG) processing is an important technique which helps in identifying abnormalities in the heart before any formal diagnosis. This research presents a real-time and lightweight R-assisted feature extraction algorithm and a heartbeat classification scheme which achieves highly accurate abnormality detection. In the proposed algorithm, we extract fifteen features from each heartbeat taken from raw Lead-II ECG signals. The features carry medically valuable information such as locations, amplitude and energy of ECG waves (P, Q, R, S, T waves) which are then used for detection of any abnormality that might be present in the heartbeat using various classification algorithms. We have used four popular databases from Physionet and extracted ten thousand ECG signals from each for training the models and benchmarking results. Four classification models i.e. Naïve Bays, k-Nearest Neighbor, Neural Network, Decision Tree were used for abnormality detection validating the efficiency of the system.

In this paper, the current technologies of the regenerative shock absorber systems have been categorized and evaluated. Three drive modes of the regenerative shock absorber systems, namely the direct drive mode, the indirect drive mode and hybrid drive mode are reviewed for their readiness to be implemented. The damping performances of the three different modes are listed and compared. Electrical circuit and control algorithms have also been evaluated to maximize the power output and to deliver the premium ride comfort and handling performance. Different types of parameterized road excitations have been applied to vehicle suspension systems to investigate the performance of the regenerative shock absorbers including that of the nonlinear regenerative shock absorber. The research gaps for comparison of the different drive modes and the nonlinearity analysis of the regenerative shock absorbers are identified and, the corresponding research questions have been proposed for future work.

Karst rocky desertification (KRD) is a process where strong anthropogenic disturbances and exposure of carbonate bedrock occurs in fragile karst ecosystems. The fractional cover of rocky outcrops is a key indicator and mechanistic driver of KRD and can be accurately assessed using remote sensing technology. Nevertheless, rugged karst terrain relief can cause shadow effects on satellite imagery and combine with high heterogeneity of karst landscapes to prevent fractional cover retrievals. In this study, we explored the feasibility of applying multispectral high spatial resolution ALOS imagery for fractional cover extraction of rocky outcrops. We selected the dimidiate pixel model (DPM), which has been applied in previous studies, and spectral mixture analysis (SMA; including simple endmember spectral mixture analysis (SESMA) and multiple endmember spectral mixture analysis (MESMA)) to explore the feasibility of using remote images for KRD monitoring and improve accuracy for estimating fractions. Results from MESMA achieved high overall accuracy (76.4%) in monitoring percentage of rocky outcrop fraction in the study area. SESMA appears to underestimate percentage of rocky outcrop likely because the development of KRD was driven by complex factors (soil erosion, dissolution and anthropogenic disturbances). This results in spectral reflectance of rocky outcrop being variable in different settings. Predicted exposed bedrock coverage using SESMA and MESMA was similar in sun-lit and shaded areas although predictions from SESMA were smaller than reference data. DPM underestimated the fractional cover of rocky outcrops on south-facing slopes and overestimated it in shaded areas. Furthermore, SESMA and MESMA effectively reduced topographic effects. We conclude that it is better to extract percentage of rocky outcrop using MESMA in the karst region of southwestern China. Remote sensing is emerging as a feasible method to extract surface condition information in heterogeneous and rugged landscapes.

Wetlands are among the most bio-diverse and highest productivity ecosystems on earth, making their monitoring a high priority to conservation, protection and management interests. Although visual interpretation of satellite images is generally precise for monitoring wetlands, recent works have emphasized computerized classification methods because of the reduction in analyst time. However, it is difficult to automatically identify wetland solely based on spectral characteristics due to the complexity of wetland ecosystems. The ability to extract wetland information rapidly and accurately is the basis and the key to wetland mapping at a large scale. Here we propose an operational method to map China wetlands based on Landsat TM data and ancillary data. On the basis of theoretical analysis of wetland automatic classification, we developed a revised multi-layer wetland classification scheme and a rule-based classification model. In the latter, supervised classification (SVM and decision tree) and unsupervised classification (ISODATA) methods were tested. Four Landsat TM images, representing various wetland eco-regions in China (i.e. the Sanjiang Plain in the northeast China, the North China Plain, the Zoige Plateau in the southwest China and the Pearl River Estuary in southeast China), were automatically classified. The overall classification accuracies were 86.57%, 96.00%, 84.51% and 88.30%, respectively, which we considered to be satisfactory accuracy. Our results indicate that issues such as the resolution of geographic data and the understanding of wetland samples should be carefully addressed in the future.

Yield calculation is an important link in modern precision agriculture, which is an effective means to improve breeding efficiency, and adjust planting and marketing plans. With the continuous progress of artificial intelligence and sensing technology, yield calculation schemes based on image processing technology have many advantages such as high accuracy, low cost, and non-destructive calculation, and have been favored by a large number of researchers. This article reviews the research progress of crop yield calculation based on remote sensing images and visible light images, describes the technical characteristics and applicable objects of different schemes, and focuses on detailed explanations of data acquisition, independent variable screening, algorithm selection and optimization. Common issues are also discussed and summarized. Finally, solutions are proposed for the main problems that have arisen so far, and future research directions are predicted, with the aim of achieving more progress and wider popularization of yield calculation solutions based on image technology.

Geopolymer, as a new type of solid waste-based inorganic cementitious material, exhibits outstanding Behavior in terms of physical and chemical performance, macro-mechanical properties and long-lasting stability, and features potential application development tendency in the field of repair and reinforcement of existing concrete structures. This paper investigates the interfacial Behavior of geopolymer mortar with OPC concrete substrate under different slag, fly ash and red mud mixing proportions, while cement mortar was used as a control group for the research. The interfacial bonding properties of the geopolymer mortar to the OPC concrete substrate were elaborated by carrying out split tensile test, two-sided shear test and three-point bending test. The scanning electron microscopy (SEM) and X-ray diffraction (XRD) were employed to further analyse the microstructural characteristics and physical phase components of the interfacial transition zone between the geopolymer mortar and the OPC concrete substrate. The results indicated that the compressive strength of slag-fly ash-red mud-based geopolymer mortar under different mixing ratio conditions was consistently superior to that of cement mortar. Overall, the interfacial bonding properties of the geopolymer mortar to the OPC concrete substrate gradually increased with the increment of the slag content, however, an evolutionary trend of minor enhancement followed by a gradual reduction was observed with the growth of the fly ash and red mud content.

Crystalline phase engineering is a prominent strategy for synergistically optimizing the sur-face-body phases of a catalyst. In this work, TiO2 nanosheets assembled into nanotubes (TNSTs) with two-phases of anatase and rutile were firstly synthesized via crystal engineering by simple thermal annealing, and subsequently loaded with Ru nanoparticles to create efficient benzene hydrogenation catalyst Ru/TNSTs. The well- designed nanosheet-tubes structure boasts large specific surface area and excellent transmission channels, which effectively prevents the ag-glomeration and deactivation of loaded Ru nanoparticles, as well as promotes the internal diffu-sion in the reaction process of benzene hydrogenation to cyclohexene. Furthermore, titanium dioxide nanosheet-tubes contain numerous Ti3+ defects, which not only improves the overall generation rate of cyclohexene, but also enhances the suppression of cyclohexene adsorption. Most importantly, the two-phases of titanium dioxide increases the ratio of the electron defi-ciencies of Ru and promotes cyclohexene desorption. These synergistic properties enhance the selectivity and efficiency of the Ru/TNSTs catalysts, resulting in excellent performance in the hydrogenation of benzene to cyclohexene. Especially the Ru/TNSTs-4 catalyst achieves a 95% in-itial selectivity and 51% yield of cyclohexene in the reaction, outperforming most supported Ru-based catalysts. This work may provide new perspectives for designing efficient benzene hydrogenation catalysts via crystalline phase engineering.

Polysaccharide from Ficus carica L. (FCP) exert multiple biological activities, as a biological macromolecule, the available knowledge about the specific structures and mechanisms of biological activity of purified 'Brunswick' fig polysaccharide is currently limited. In the present study, by chemical purification and characteristics identified via specific instruments, and then the impact of FCP on the immunomodulation activity in vitro and in vivo was examined. Structural char-acteristics showed that the molecular weight of the FCP was determined to be 127.5 kDa, the primary monosaccharides present in the FCP were galacturonic acid (GalA), arabinose (Ara), galactose (Gal), rhamnose (Rha), glucose (Glc), and xylose (Xyl) at a ratio of 0.321:0.287:0.269:0.091:0.013:0.011. Based on the investigation of in vitro immunomodulatory ac-tivity, FCP was found to stimulate the production of NO, TNF-α, and IL-6 and increased the pi-nocytic activity of macrophages. Further analysis revealed that FCP activated macrophages by interacting with toll-like receptor 4 (TLR4). Moreover, the in vivo test results indicate that FCP showed significant increase serum pro-inflammatory factors in immunosuppressed mice. Overall, this study suggests that FCP has the potential to be utilized as a novel immunomodulator in the pharmaceutical and functional food industries.

Structurally clear compounds have advantages for quality control in plant biostimulant production and application processes. Humic acid (HA) is a biostimulant that significantly affects plant growth, and soil-dwelling Protaetia brevitarsis larva (PBL) can rapidly convert agricultural waste into HA. In this study, we use PBL as a model to investigate HA formation and screen for HA-related structurally clear plant biostimulant compounds. The dephasing magic angle spinning nuclear magnetic resonance (13C DD–MAS NMR) analysis indicated HA structural changes during PBL digestion; the metabolic profile detected seven HA-related aromatic ring-containing compounds. Plant experiments identified six compounds with stimulating effects, with piperic acid being reported for the first time in this study. Thus, this study not only provides insights into the insect-mediated transformation of HA but also illustrates a new strategy for discovering structurally clear plant biostimulant compounds.

In this study, we resequenced the mitogenomes of P. megacephalus from different regions using a “primer bridging” approach with Sanger sequencing technologies. The mitogenome of this species was found to contain two copies of the ND5 genes and three copies of the control regions. Furthermore, multiple tandem repeats were identified in the control regions. Notably, we observed that there was no correlation between the distribution of species and their genetic distance. However, our research revealed the discovery of the “missing” ATP8 gene in P. megacephalus as well as three other previously published Polypedates, as a result of manual data curation. Using the mitogenome, gene expression analysis was performed via RT-qPCR of liver samples and determined that COIII, ND2, ND4, and ND6 were reduced to 0.64±0.24, 0.55±0.34, 0.44±0.21 and 0.65±0.17 under the low-temperature stress (8℃), respectively, as compared with controls (P<0.05). Remarkably, the transcript of long non-coding RNA (LncRNA) between positions 8029 and 8612 decreased significantly with exposure to low-temperature stress (8℃). Antisense ND6 gene expression showed a downward trend but this was not significant. These results reveal that modulations of protein-coding mitogenomes genes and lncRNAs of P. megacephalus play a crucial part in the molecular response to cold stress.

Mouse embryonic stem cells (mESCs) possess remarkable characteristics of unlimited self-renewal and pluripotency, which render them highly valuable for both fundamental research and clinical applications. A comprehensive understanding of the molecular mechanisms underlying mESC function is of utmost importance. The Human Silence Hub (HUSH) complex, comprising FAM208A, MPP8, and periphilin, constitutes an epigenetic silencing complex involved in suppressing retroviruses and transposons during early embryonic development. However, its precise role in regulating mESC pluripotency and differentiation remains elusive. In this study, we generated homogenous miniIAA7 tagged Mpp8 mouse ES cell lines. Upon induction of MPP8 protein degradation, we observed impaired proliferation and reduced colony formation ability of mESCs. Furthermore, this study unveils the involvement of MPP8 in regulating the activity of the LIF/STAT3 signaling pathway and Nanog expression in mESCs. Finally, we provide compelling evidence that degradation of the MPP8 protein impairs the differentiation of mESC.

Chitosan (CTS) is widely used in agriculture as a soil amendment, plant growth regulator and promoter of cold resistance. However, the effects of CTS on strawberry seedlings under the combined stress of high-temperature and high-light are unclear. In this study, Xuelixiang strawberry was used as a test material, and 100 mg·kg-1 CTS solution was sprayed onto the leaves. We measured the chlorophyll content, membrane peroxidation, reactive oxygen species content, antioxidant enzyme content, AsA-GSH cycle activity and other related indicators of strawberry seedling leaves under the combined stress of high-temperature and high-light and found that CTS can increase the contents of antioxidants, increase the contents of osmotic adjustment substances, increase the activity of antioxidant enzymes activity,; remove reactive oxygen species over time, reduce the damage of reactive oxygen species to photosynthetic organs and cell membranes, and improve the photosynthesis efficiency of leaves of strawberry plants under high-temperature and high-light stress, thereby reducing damage to strawberry seedlings caused by high-temperature and high-light.

The Coronavirus disease 2019 (COVID-19) pandemic began in Jan. 2020 in Wuhan, China with a new coronavirus designated SARS-CoV-2. The principle cause of death from COVID-19 disease quickly emerged as Acute Respiratory Distress Syndrome (ARDS). A key ARDS pathogenic mechanism is the “Cytokine Storm”. This is a dramatic increase in the blood of inflammatory cytokines. In the last 2 years of the pandemic new pathology has emerged in COVID-19 survivors in which a variety of long-term symptoms emerge. This condition is called “Long COVID”. The spike protein on the surface of the virus (target for the new mRNA/DNA vaccines) is composed of joined S1-S2 subunits. Upon S1 bind-ing to the human ACE2 receptor on cells, the S1 subunit is cleaved and the S2 subunit me-diates entry of the virus. The S1 protein is then released into the blood, which might be one of the pivotal triggers for initiation and/or perpetuation of the cytokine storm. In this study, we tested the hypothesis that the spike S1 protein may activate inflammatory sig-naling and cytokine production independent of the virus. Our data support a potential role for spike S1 activation of inflammatory signaling and cytokine production in human lung and intestinal epithelial cells in culture. These data support a potential role for the SARS-CoV-2 spike S1 protein in COVID-19 pathogenesis.

This paper aims to explore the effect of humble leadership on project success by integrating the mediating role of employee creativity. Top management support moderates the direct relationship (humble leadership and project management effectiveness) and indirect relationships through employee creativity. Time-lagged data were obtained from 332 persons working in the matrix organization across the information technology. The results showed that humble leadership enhance project management effectiveness by mediating and moderating processes. This study provides a solution to an underlying research question that has gone unanswered in prior studies. What are the strategies proposed for humble leadership in fostering the effectiveness of the project?

Background: Hepatocellular carcinoma (HCC) is one of most common cancers with a high mortality rate. HBV/HCV infection is an important risk factor to trigger HCC. Therefore, developing serum biomarkers for early diagnosis is crucial to prolong survival in HCC patients. Methods: An antibody array technology was utilized to detect serum from 20 HBV-related HCC patients, 20 chronic hepatitis B patients and 20 normal population, whose results were further validated by ELISA. Results: Both antibody array and ELISA showed that ten growth factors (SCF R, GDF-15, HGF, FGF-4, IGFBP-1, PIGF, GH, GDNF, BDNF and IGF-1) were significantly differential in HCC patients when compared to the non-HCC population. Among these growth factors, the levels of SCF R, GDF-15, HGF, GH and IGF-1 showed significant correlation with hepatitis B and its severity, indicating that these growth factors may promote HCC progression by an HBV-specific mechanism. A therapy targeting these growth factors in hepatitis B patients may help to prevent the development of HCC. FGF4 and GH were found, for the first time, to be upregulated in HCC, suggesting that these two growth factors may serve as novel serum biomarkers for the early diagnosis of HCC. Conclusion: The combined detection of all the differential growth factors may improve the diagnostic accuracy of HCC.

A method for measuring the mechanical parameters of viscoelastic polymers by nanoindentation technology was proposed and verified. Through the mechanical response of load-displacement curves at different loading rates, then creep compliances and relaxation modulus were fitted. Polyimide thin film was employed in this research and experiments for five different loading rates were conducted. The fitting load-displacement loading curves obtained by the inversion method were identical to the experimental curves at five different loading rates，confirming the validity of the method. Moreover, with the loading rates increased，the fitting curves were more consistent commensurately with the nanoindentation experiment. DMA experiments were tested, and the generalized Kelvin/ Maxwell model were used for fitting experiment data. Results from DMA tests generally agree well with data from nanoindentation method, thereby verifying the feasibility of the method. The Prony series obtained by the two methods were used to simulate the creep experiments, which further verified the method.