The astacin protease Meprin β represents an emerging target for drug development due to its potential involvement in disorders such as acute and chronic kidney injury and fibrosis. Here, we elaborate on the structural basis of inhibition by a specific Meprin β inhibitor. Our analysis of the crystal structure suggests different binding modes of the inhibitor to the active site. This flexibility is caused, at least in part, by movement of the C-terminal region of the protease domain (CTD). The CTD movement narrows the active site cleft upon inhibitor binding. Compared with other astacin proteases, among those the highly homologous isoenzyme Meprin α, differences in the subsites account for the unique selectivity of the inhibitor. Although the inhibitor shows substantial flexibility in the orientation within the active site, the structural data as well as binding analyses including molecular dynamics simulations support a contribution of electrostatic interactions, presumably by arginine residues, to binding and specificity. Collectively, the results presented here and previously support an induced fit and substantial movement of the CTD upon ligand binding and, possibly, during catalysis. To the best of our knowledge, we here present the first structure of a Meprin β holoenzyme containing a zinc ion and a specific inhibitor bound to the active site. The structural data will guide rational drug design and the discovery of highly potent Meprin inhibitors.

This article objectively assesses, the hypothesis of the streamline's shape theory and its formulated equation. The deduction of proof uses algebra rather than first-order partial differential equations to address the specific hypothesis of "Streamline's shape theory" from the fundamental perspective of applied mathematics and scientifically derives mathematical relations of the axioms and corollaries in the field of fluid dynamics. The algebraic methods employed provide progressively more distinct and precise solutions compared to first-order partial differential equations. The foremost objective of this work is to evaluate if the formulations of the streamline's shape theory can have solutions for inviscid-incompressible and viscid-compressible flows of Newtonian fluids and to identify their nature. Secondly, to understand how the topology of the body and the free-stream conditions affect these solutions with due regards to the shape and size of the body interacting with the fluid flow. Finally, to explore the possibility of this theory to develop a CFD solver for streamline simulation to reduce the experimentation in the analysis of flow-structure interactions of Newtonian fluids and also to identify its scope of applications and limitations.

The article presents a new approach to the analysis of the stability of automatic systems with discrete links.In almost all modern automatic control systems, there are links that break signals in time. These are power controlled switches - transistors or thyristors operating in a pulsed mode and digital links in regulators.Time discretization significantly affects the stability of processes in the automatic control system. The theoretical analysis of such systems is rather complicated and requires a significant change in engineering approaches to analysis. In connection with the improvement of digital controllers and a significant increase in their performance, in recent years this problem has practically not been remembered. However, its mathematical "content" has not changed since the 80s of the 20th century, when discreteness began to play a major role among the problems hindering progress in automatic control systems, in terms of the transition to digital systems.In this paper, a new approach is proposed, which consists in interpreting the sampling operation by a link with the proposed frequency characteristic, which determines the suppression of input high-frequency signals. This link greatly simplifies engineering calculations and demonstrates the new capabilities of sampling systems. These possibilities include the rational distribution of digitalization resources - the number of bits and the sampling interval between the regulator channels, depending on the frequency range of the efficiency of these channels. Theoretical statements have been verified and confirmed by simulation. It is shown how this approach makes it possible to formulate new principles of construction of seemingly well-known controllers - PID controllers and variable structure systems (VSS).

The notion that dust might have formed the cosmic microwave background (CMB) has been strongly refuted on the strength of four decades of observation and analysis, in favour of recombination at a redshift z ~ 1080. But tension with the data is growing in several other areas, including measurements of the Hubble constant H(z) and the BAO scale, which directly or indirectly impact the physics at the surface of last scattering (LSS). The R_h=ct universe resolves at least some of this tension. We show in this paper that---if the BAO scale is in fact equal to the acoustic horizon---the redshift of the LSS in this cosmology is z_cmb ~ 16, placing it within the era of Pop III star formation, prior to the epoch of reionization at 15 > z > 6. Quite remarkably, the measured values of z_cmb and H_0 = H(0) in this model are sufficient to argue that the CMB temperature today ought to be ~ 3 K, so H_0 and the baryon to photon ratio are not independent free parameters. This scenario might have resulted from rethermalization of the CMB photons by dust, presumably supplied to the interstellar medium by the ejecta of Pop III stars. Dust rethermalization may therefore yet resurface as a relevant ingredient in the R_h=ct universe. Upcoming high sensitivity instruments should be able to readily distinguish between the recombination and dust scenarios by either (i) detecting recombination lines at z ~ 1080, or (ii) establishing a robust frequency-dependent variation of the CMB power spectrum at the level of ~ 2-4% across the sampled frequency range.

Protein is the proteios building block of life. Evolutionarily, its sequence is not as conserved as its structure, making it more reasonable for protein structure, instead of protein sequence, to be the descriptor of protein function. Yet, in the National Center for Biotechnology Information (NCBI) database, the number of experimentally identified protein sequences is in great excess of that of experimentally determined protein structures inside the almost-half-a-century old Protein Data Bank (PDB). For instance, GPR151 is an proton-sensing G-protein coupled receptor (GPCR) originally identified as homologous to galanin receptors. As of March 19, 2020, GPR151’s structure has not been experimentally determined and deposited in PDB yet. Thus, an ab initio modelling approach was employed here to build a three-dimensional structure of GPR151. Overall, the ab initio GPR151 model presented herein constitutes the first structural hypothesis of GPR151 to be experimentally tested in future with previously published, currently ongoing and future GPR151 studies.

Purpose: To improve numerical simulation of the non-contact tonometry test by using Arbitrary Eulerian-Lagrangian deforming mesh in the coupling between computational fluid dynamics model of an air jet and finite element model of the human eye. Methods: Computational fluid dynamics model simulated impingement of the air puff and consisted of 25920 wedge6 elements and employed Spallart-Allmaras model to simulate capture turbulence of the air jet. The time span of the jet wais 30 ms and maximum Reynolds number

G protein-coupled receptors (GPCRs) are critical drug targets. GPCRs convey signals from the extracellular to the intracellular environment through G proteins. There is evidence that some ligands that bind to the GPCRs activate different downstream signaling pathways. G protein activation or -arrestin biased signaling involves ligands binding to receptors and stabilizing conformations that trigger a specific pathway. Molecular dynamics (MD) simulations are especially valuable for obtaining detailed mechanistic information, including identification of allosteric sites and understanding modulators' interactions between receptors and ligands. Here, we highlight recent simulation studies and methods used to study biased G protein-coupled receptor signaling and their conformational dynamics. We also highlight applications of MD simulations to drug discovery.

A rigorous model for the electron is presented by generalizing the Coulomb's Law or Gauss's Law of electrostatics, using a unified theory of electricity and gravity. The permittivity of the free-space is allowed to be variable, dependent on the energy density associated with the electric field at a given location, employing generalized concepts of gravity and mass/energy density. The electric field becomes a non-linear function of the source charge, where concept of the energy density needs to be properly defined. Stable solutions are derived for a spherically symmetric, surface-charge distribution of an elementary charge. This is implemented by assuming that the gravitational field and its equivalent permittivity function is proportional to the energy density, as a simple first-order approximation, with the constant of proportionality referred to as the Unifield Electro-Gravity (UEG) constant. The stable solution with the lowest mass/energy is assumed to represent a ``static'' electron without any spin. Further, assuming that the mass/energy of a static electron is half of the total mass/energy of an electron including its spin contribution, the required UEG constant is estimated. More fundamentally, the lowest stable mass of a static elementary charged particle, its associated classical radius, and the UEG constant are related to each other by a dimensionless constant, independent of any specific value of the charge or mass of the particle. This dimensionless constant is numerologically found to be closely related to the the fine structure constant. This possible origin of the fine structure constant is further strengthened by applying the proposed theory to successfully model the Casimir effect, from which approximately the same above relationship between the UEG constant, electron's mass and classical radius, and the fine structure constant, emerges.

The synthesis and structure of the 4,4′-dipyridyl N,N′-donor ligand with a central thiazolo[5,4-d]thiazole (tztz) unit, named Dptztz is presented. With the linker Dptztz and isophthalate (benzene-1,3-dicarboxylate, 1,3-BDC²⁻) the mixed-linker, two-dimensional coordination network [Zn(1,3-BDC)Dptztz]·DMF could be obtained (DMF = dimethylformamide), which belongs to the class of coordination polymers with interdigitated structures (CIDs). The incorporated DMF solvent molecules can be removed through solvent exchange and evacuation such that the supramolecular 3D packing of the 2D networks retains porosity for CO₂ adsorption in activated [Zn(1,3-BDC)Dptztz]. The first sorption study of a tztz-functionalized porous metal-organic framework material yields a BET surface of 417 m²/g from CO₂ adsorption. The heat of adsorption for CO₂ exhibits a relative maximum with 27.7 kJ/mol at adsorbed CO₂ of about 4 cm³/g STP which is interpreted as a gate-opening effect.

The detection of dopamine in a highly sensitive and selective manner is crucial for the early diagnosis of a number of neurological diseases/disorders. Here, a report on a new platform for the electrochemical detection of dopamine with a considerable accuracy that comprises a 3D porous graphene oxide (pGO)/gold nanoparticle (GNP)/pGO composite-modified indium tin oxide (ITO) is presented. The pGO was first synthesized and purified by ultrasonication and centrifugation, and it was then further functionalized on the surface of a GNP-immobilized ITO electrode. Remarkably, owing to the synergistic effects of the pGO and GNPs, the 3D pGO-GNP-pGO-modified ITO electrode showed a superior dopamine-detection performance compared with the other pGO- or GNP-modified ITO electrodes. The linear range of the newly developed sensing platform is from 0.1 μM to 30 μM with a limit of detection (LOD) of 1.28 μM, which is more precise than the other previously reported GO-functionalized electrodes. Moreover, the 3D pGO-GNP-pGO-modified ITO electrodes maintained their detection capability even in the presence of several interfering molecules (e.g., ascorbic acid, glucose). The proposed platform of the 3D pGO-GNP-pGO-modified ITO electrode could therefore serve as a competent candidate for the development of a dopamine-sensing platform that is potentially applicable for the early diagnosis of various neurological diseases/disorders.

In this work, we investigated the effects of heat treatment on the microstructure, hydrogen storage characteristics and corrosion rate of a Ti₃₄V₄₀Cr₂₄Fe₂ alloy. The arc melted alloy was divided into three samples, two of which were separately quartz-sealed under vacuum and heated to 1000 °C for 1 h; one of these samples was quenched and the other furnace cooled to ambient temperature. The crystal structures of the samples were studied via X-ray diffractometry and scanning electron microscopy. Absorption/desorption characteristics were investigated using a Sievert apparatus. Potentiostat corrosion tests on the alloys were performed using an AutoLab^® corrosion test apparatus and electrochemical cell. All samples exhibited a mixture of body-center-cubic (BCC) and Laves phase structures. The corrosion rate, maximum absorption, and useful capacities increased after both heat treatments. The annealed sample had the highest absorption and reversible capacity. The plateau pressure of the as-cast alloy increased after quenching. The corrosion rate increased from 0.0004 mm/y in as-cast sample to 0.0009 mm/y after annealing and 0.0017 mm/y after quenching, due to a decrease in the Cr-content of the C14 phase.

The fishery biology of the invasive Atlantic blue crab Callinectes sapidus in the Mediterranean Sea outside the eastern sectors of the basin has been only recently investigated. Here we studied the population of C. sapidus in the Lesina Lagoon (Adriatic Sea, SE Italy). In total, 838 crabs were captured monthly between February 2021 and January 2022 using fyke nets. Abundances varied seasonally with catches per unit effort ranging between 0 and 1.76 crabs fyke nets-1 d-1 in winter and summer. Spatial abundances estimated in summer by a Carle-Strub procedure ranged between 0.06 and 0.64 crabs m-2. Sex ratio (♂/♀) was close to 1:1; males prevailed only in August and September; ovigerous females occurred from April to August. Males’ size at morphological maturity was smaller than females (110.6-112.3 mm vs. 122.1-123.1 mm). Seasonal von Bertalanffy growth parameters indicated that, compared with males, females showed a shorter maximum lifespan (5 vs. 8 years), a higher growth coefficient K (0.6 vs. 0.4 y-1) and growth performance index ' (4.6 vs. 4.3), while maximum sizes CW∞ (237.8 vs. 232.6 mm) and seasonality indices C (0.62 vs. 0.57) were similar. Furthermore, females showed higher natural and fishing mortalities and exploitation rate. We discussed the results of the present study in the context of the available literature to provide a valuable basis for the implementation of standardised Mediterranean-scale management plans, matching exploitation of C. sapidus with sustainable conservation of coastal ecosystems.

The effective macroscopic model describing interactions of a viscous compressible heat-conducting fluid and a two-level fine bristly thermoelastic structure is derived from microstructure by means of the Allaire–Briane multi-scale convergence method. This new model naturally generalizes the isothermal formulation earlier constructed by the authors in 2020, see in Siberian Electronic Mathematical Reports, vol. 17 (https://doi.org/10.33048/semi.2020.17.100). In applications, the established model can be used, for example, in description, with account of heat transfer phenomemon, of airflow near surface of plant’s leaf, in simulation of epithelium surfaces of blood vessels, and in design of biotechnological devices operating in liquids.

In ocean engineering, accurate and efficient numerical simulations are crucial. Leveraging axisymmetry vastly enhances the efficiency of a simulation, reducing a three-dimensional scenario to a two-dimensional simulation. Exploiting axisymmetry enables a significant reduction in computational demand while maintaining simulation fidelity. In this paper, axisymmetry is leveraged to perform a large ensemble of simulations, in order to evaluate and maximise the accuracy and efficiency of a Computational Fluid Dynamics (CFD) simulation. In particular, the free decay motion and wave radiation from a heaving semi-submerged sphere are simulated, using the Reynolds Averaged Navier Stokes (RANS) solver, interFOAM, in the opensource finite volume CFD software OpenFOAM. Validated against highly accurate experimental data, extensive parametric studies are conducted, previously limited by computational constraints, which facilitate the refinement of simulation setups. More than 50 iterations of the same heaving sphere simulation are performed, informing efficient trade-offs between computational cost and accuracy across various simulation parameters and mesh configurations. Ultimately, by employing axisymmetry, this research contributes to the development of more accurate and efficient numerical modeling in ocean engineering.

The dynamic response of the shed-tunnel structure under rockfall impact attracts much attention in recent years. However, the research on the dynamic response of the shed-tunnel structure under rockfall impact mostly focuses on the rockfall single impact, while in practical engineering, the shed-tunnel structure often encounters the rockfall repeated impacts during its service life. Therefore, this research focuses on exploring the dynamic response characteristics of the shed-tunnel structure under the rockfall repeated impacts. First of all, based on the model test of the shed-tunnel under rockfall impact as a reference, the FEM (Finite Element Method)-SPH (Smoothed Particle Hydrodynamics) coupling numerical calculation model is established based on ANSYS/LS-DYNA finite element code. The numerical simulation of the dynamic response of the shed-tunnel structure under rockfall impact is realized, and the rationality of the model is verified. Then, with this model and the full restart technology of LS-DYNA code, the effects of four factors, e.g. rockfall mass, rockfall impact velocity, rockfall impact angle and rockfall shape, on the impact force and impact depth of the buffer layer, the maximum plastic strain and axial force of the rebar, the shed roof vertical displacement and the shed-tunnel plastic strain are studied. These results show that the cumulative deformation and damage of the shed-tunnel structure caused by the rockfall repeated impacts play an important role in the destruction of the shed-tunnel structure, and the special attention should be paid to this issue.

Ming-style round-backed armchairs as a classic Chinese chair design are renowned for the blend of ergonomics, practicality, and elegance. Although the Chinese armchair furniture industry has made strides in sustainability, there is still a need for further improvements in material selection, manufacturing processes, and supply chain management to fully support the development of sustainable furniture. Laminated bamboo lumber as new sustainable materials are becoming a popular option for furniture designers in the era of "sustainable design". This research aims to investigate the feasibility and application of laminated bamboo lumber in the design of Chinese armchair furniture and proposes innovative ideas for optimizing the armchair's design. First, an empirical study was conducted to comprehensively understand the classification of Ming-style round-backed armchairs’ structure to develop a 3D model. Secondly, an experimental research method was then employed to explore the parameters of laminated bamboo lumber for future studies. Additionally, a validation experiment was conducted to compare real-world scenarios with simulations using finite element analysis in Ansys. Finally, finite element analysis was used to test the feasibility and application of laminated bamboo lumber in furniture design, focusing on the material’s mechanical properties. Results indicated that laminated bamboo lumber has excellent mechanical properties as furniture design materials, subsequently, using the optimized results, the use of 0.6319 kg of steel was successfully reduced by 23.68% to ensure the armchair’s stability. This provides a reference for the future compter-assist and standardized innovative design of Chinese armchair. By incorporating compter-assist design and lightweight optimization, it is possible to save materials and make more efficient use of resources, thereby contributing to sustainable development goals in the field of furniture design.

We present first-principles DFT+U investigation of the bulk properties including structural, energetic and mechanical properties for uranium-americium mixed oxides (U, Am)O₂. The various Am aggregation contents have been investigated to better understand the impact of Am in the nuclear fuel UO₂. The supercell defect models at different scales were used to describe the solid solution (U, Am)O₂. The obtained results show that different contents of Am has a significant impact on the volume and energy of the mixed oxides systems. The results on the electronic structure calculations exhibit a narrow band gap owing to the mixing of UO₂ and AmO₂. The mixing enthalpy of the Am aggregation systems are used to describe the phase stability for the solid solution. In particular, mixing enthalpy of the (U, Am)O₂ significantly reduced as the Am content increases. The elastic properties of the (U, Am)O₂ mixed oxides have also been compared as a function of Am content. Moreover, the impacts of the whole Pu aggregation content range on the bulk properties for the (U, Pu)O₂ mixed oxides is also discussed.

The direct detection of dark matter constituents, in particular the weakly interacting massive particles (WIMPs), is central to particle physics and cosmology. In this paper we develop the formalism for WIMP-Nucleus induced transitions from isomeric nuclear states. We specialize it in the case of the experimentally interesting target 180 Ta

Polyesters based advanced thin films have versatile industrial applications, especially in the filed of textiles, packaging and electronics. Recent advances in polymer science and engineering resulted in development of advanced amorphous and semi-crystalline polyesters with exceptional performance compared to conventional polymeric films. Among these, 1,4-cycloheanedimethanol (CHDM) and cyclic monomer-based polyesters have gained considerable attention attention for their exceptional characteristics and potential applications in smart films. This review article provides a comprehensive overview of the recent advances in the synthesis, characterization, and applications of CHDM and cyclic monomer based advanced polymers for smart film applications. It discussed the structure-property relationship of these innovative polyesters and highlights their unique characteristics including thermal, mechanical, and barrier characteristics. Furthermore, this article also emphases the solution, melt, and solid state polymerization of the polymers. Special emphasis is placed on the influence of the addition of 2nd diol or 2nd diacid on the performance characteristics of synthesized polyesters/copolyesters to explore their versatile industrial applications. Additionally, the impact of stereochemistry of the monomers is also explored to optimized the characterization of polyester, suitable for the industrial applications. Furthermore, this article explores the potential of these advanced polyesters to be considered as a potential materials for smart film applications, especially in the filed of flexible electronics. Finally, the article examines the challenges and future recommendations for the development CHDM and cyclic monomer-based polyesters for smart film applications. It discusses potential avenues for further research, including in-depth studies for the synthesis and characterization of polyesters, development of sustainable and biodegradable alternatives cyclic monomers, alternative green approaches for the synthesis of polymers etc. This review article provides a valuable insights for the researcher from academia and industry working in the field of polymer science and materials engineering.

The COVID 19 pandemic saw the emergence of various Variants of Concern (VOCs) that took the world by storm, often replacing the ones that preceded them. The characteristic mutant constellations of these VOCs increased viral transmissibility and infectivity. Their origin and evolution remain puzzling. With the help of data mining efforts and the GISAID database, a chronology of 22 haplotypes described viral evolution up until July 23, 2023. Since the 3-dimensional atomic structures of proteins corresponding to the identified haplotypes are not available, ab initio methods were here utilized. Regions of intrinsic disorder proved to be important for viral evolution, as evidenced by the targeted change to the nucleocapsid (N) protein at the sequence, structure, and biochemical levels. The linker region of the N-protein, which binds to the RNA genome and self-oligomerizes for efficient genome packaging, was greatly impacted by mutations throughout the pandemic, followed by changes in structure and intrinsic disorder. Remarkably, VOC constellations acted cooperatively to balance the more extreme effects of individual haplotypes. Our strategy of mapping the dynamic evolutionary landscape of genetically linked mutations to the N-protein structure demonstrates the utility of ab initio modeling and deep learning tools for therapeutic intervention.

In this paper, we explore the hypothesis that topological defects formed in the quark-gluon plasma (QGP) of the early universe, specifically flux tubes and domain walls, could serve as stable dark matter candidates. Theoretical analysis of the QCD vacuum structure reveals that these defects can form due to nontrivial topological configurations, with the Lagrangian density incorporating topological terms. We model the formation and stability of flux tubes and domain walls, estimating their energy densities and dynamics within the QGP. Flux tubes, with energy per unit length approximately given by $\mu \approx \frac{\sigma}{g_s^2}$, and domain walls, characterized by a surface energy density $\sigma_{\text{DW}} \sim \Lambda_{\text{QCD}}^3$, exhibit unique gravitational signatures. These signatures include distinct gravitational lensing patterns due to their linear and planar mass distributions, making them detectable through astrophysical surveys. Furthermore, their minimal interaction with conventional matter aligns well with observational constraints on dark matter properties. We discuss potential experimental approaches for detecting these defects, including high-energy collider experiments and detailed analysis of gravitational lensing data. Our findings suggest that topological defects in the QGP provide a compelling and novel solution to the dark matter problem, offering a new direction for both theoretical investigation and experimental verification.

Virus taxonomy uses a Linnaean-like subsumption hierarchy to classify viruses into taxonomic units at species and higher rank levels. Virus species are considered monophyletic groups of mobile genetic elements (MGEs) often delimited by phylogenetic analysis of aligned genomic or metagenomic sequences. Taxonomic units are assumed independent organizational, functional and evolutionary units that follow a ‘natural’ historical rationale. Here, I use phylogenomic and other arguments to show that viruses are not self-standing genetically-driven biological systems. Instead, they are crucial components of holobionts, units of biological organization that dynamically integrate the genetics, epigenetic, physiological and functional properties of their co-evolving members. Remarkably, phylogenomic analyses show viruses share protein domain and loop structures with cells throughout history via massive processes of reticulate evolution, helping spread evolutionary innovations across a wider taxonomic spectrum. Thus, viruses are not merely MGEs or microbes. Instead, their genomes and proteomes conduct cellularly integrated processes akin to those cataloged by the GO Consortium. This prompts the generation of compositional hierarchies that replace the ‘is-a-kind-of’ by a ‘is-a-part-of’ logic to better describe the mereology of integrated cellular and viral makeup. My analysis demands a new paradigm that integrates virus taxonomy into a modern evolutionarily centered taxonomy of organisms.

In this communication, we present an innovative approach leveraging advanced Machine Learning (ML) and Artificial Intelligence (AI) techniques, specifically the Non-Negative Matrix Factorization (NMF) method, to analyze downward and upward light spectra collected by Hyperspectral Ocean Color Radiometer (HyperOCR, HOCR) sensors in the water column. Our work focuses on the development of a robust and efficient tool for unraveling the structure and activities of natural microbial assemblages in the ocean. By applying the NMF method to HyperOCR data, we successfully extracted five spectral signatures, representing unique patterns in the data. These signatures were instrumental in predicting the abundances of various microbial components, including bacteria, heterotrophic nanoflagellates, and picoeukaryotes, showcasing the potential of ML and AI in advancing oceanographic studies. To validate the methods, the study area included a shallow coastal area under the influence of freshwater inflow and an open offshore area with a depth of 100 m. The study sites in coastal and offshore waters (Kaštela Bay and Stončica Vis, respectively) had significantly different hydrographic and microbiological characteristics. Kaštela Bay had lower temperatures and salinity than the site on Vis. We have proved by application of different AI and ML methods with specific HOCR sensors prediction of the structure of the microbial community.

The Ames/quantitative structure-activity relationship (QSAR) International Challenge Projects held during 2014–2017 and 2020–2022, evaluated the performance of various predictive models. Despite the significant insights gained, the rules allowing participants to select prediction targets introduced ambiguity in model performance evaluation. This reanalysis identified the highest-performing prediction model, assuming a 100% coverage rate (COV) for all prediction target compounds and an estimated performance variation due to changes in COV. All models from both projects were evaluated using balance accuracy (BA), Matthews correlation coefficient (MCC), F1 Score (F1), and the first principal component (PC1). After normalizing the COV, a correlation analysis with these indicators was conducted, and the evaluation index for all prediction models in terms of the COV was estimated. In total, 109 models, the highest estimated BA (76.9) at 100% COV was MMI-VOTE1, reported by Meiji Pharmaceutical University (MPU). The best models for MCC, F1, and PC1 were all MMI-STK1, also reported by MPU. All models reported by MPU ranked in the top four. MMI-STK1 was estimated to have F1 scores of 59.2, 61.5, and 63.1 at COV levels of 90%, 60%, and 30%, respectively. These findings highlight the current state and potential of the Ames prediction technology.

The effects of the coolant pulsation and the film cooling with the plasma aerodynamic actuation (PAA) could be herein explored via large eddy simulations. The electrohydrodynamic force derived from the PAA was solved through the phenomenological plasma model. The Strouhal number of the sinusoidal coolant pulsation and the averaged pulsation blowing ratio were 0.25 and 1.0, respectively. Comprehensive analyses were carried out on the time-averaged flow fields, and the results revealed that the pulsed cooling jet might cause a deeper penetration into the crossflow, and this phenomenon could be remarkably mitigated by the downward force of the PAA. Furthermore, because of the coolant pulsation, the counter rotating vortex pair (CRVP) expanded to lifted off the wall less well, and the PAA lessened the negative lift-off impact and entrapment from the CRVP. Then, the spatial-temporal development of the coherent structures was figured out by the alterations of the centerline temperature, reflecting formation of the intermittent coherent structures rather than hairpin vortices due to the coolant pulsation, and their size and upcast behaviors were reduced by the PAA. Consequently, there was a basic suppression of the turbulent mixing of the cooling fluid with the crossflow. Finally, the three-dimensional streamlines confirmed that the coherent structure dynamic behaviors were significantly regulated by the PAA for alleviating the adverse influences of the coolant pulsation. In summary, through controlling how the dominating coherent structures evolve throughout time and space, the PAA can effectively increase the pulsed film cooling efficiency.

AlphaFold is a groundbreaking Deep Learning tool for protein structure prediction. It achieved remarkable accuracy in modeling the many 3D structures while taking as the input only the known amino acid sequence of proteins in question. Intriguingly though, in the early steps of each individual structure prediction procedure, AlphaFold is not respecting topological barriers that in real proteins result from the reciprocals impermeability of polypeptide chains. This study aims to investigate how this non-respecting of topological barriers affects AlphaFold predictions with respect to the topology of protein chains. We focus on such classes of proteins that during their natural folding form reproducibly the same knot type on their linear polypeptide chain as revealed by their crystallographic analysis. We use partially artificial test constructs in which the mutual non-permeability of polypeptide chains should not permit the formation of such knots during natural protein folding. We find that despite the formal impossibility that the protein folding process could produce such knots, AlphaFold predicts these proteins to be knotted. Our study underscores the necessity for cautious interpretation and further validation of topological features in protein structures predicted by AlphaFold.

The Easternmost Mediterranean is a junction zone between the largest Earth's lithospheric segments – Eurasian and African-Arabian, and a transition area from the ocean to the continent. The latest catastrophic earthquakes in eastern Turkey require their geodynamic understanding. The two most decisive events (with magnitude (M) = 7.8 and 7.7) were observed with an interval of 9 hours on February 06, 2023, followed by a whole series of about 10,000 significative aftershocks. These tragic events led to the death of more than 60 thousand people. The above values indicate the colossal tension created in the Earth's crust. The region where these strongest earthquakes occurred is a tectonically very complex junction zone of four tectonic plates: Eurasian, Arabian, African, and Anatolian. The joint movement of these plates (consisting, in turn, of tectonic elements of different ages) occurs at an average rate of 6–15 mm per year. However, after two marked powerful shocks and a series of aftershocks, some sectors of the Anatolian plate shifted to the southwest by more than 11 meters. What happened in eastern Turkey? The interaction of numerous factors complicates the tectonic–geodynamic characteristics of the region. Let us analyze what is the most influencing component. Our recent publications (Eppelbaum et al., 2020, 2021) indicated the presence of a giant, rotating quasi-ring structure below the Easternmost Mediterranean. The GPS vector map coinciding with the gravitational trend displays the counterclockwise rotation of this structure. A review of paleomagnetic data on the projection of the discovered structure into the Earth's surface confirms its mainly counterclockwise rotation. Analysis of the magnetic field ΔZ, geoid anomalies map, and seismic tomography data commonly prove the presence of this deep anomaly. The geodynamic and structural characteristics of the region and paleobiogeographic data are consistent with the proposed physical–geological model. A widespread analysis of tectonic, petrological, and mineralogical data implies a connection between the discovered deep structure and near-surface processes. An examination of numerous publications by different authors confirms the above phenomenon’s existence. A crucial for understanding the nature of the considered seismic stress is its location near the expressed bend of the Mesozoic terrane belt, where the Arabian Plate is deeply intruded into the Alpine-Himalayan belt. Thus, the rotation of this giant deep structure may accumulate the stress effect and be one of the causative reasons for the last catastrophic geodynamic events in Eastern Turkey.

Intraband energy transitions of an electron in GaAs/AlGaAs hexagonal quantum well wires in the presence of external electric and magnetic fields are presented. We consider the effects of the revolve of the quantum well wires via a geometric factor that converts the quantum wires straight and symmetric with respect to the z−axis, into a curved wires that no longer has this symmetry. In addition, the influence of having a shallow donor impurity on (off) is calculated. The shape of this quantum string corresponds to the core/shell structure. The energy levels and wave functions of the electron in the heterostructure with a finite potential between the shells are calculated using the effective mass approximation and the finite element method. The calculations of the optical properties are obtained from the compact density matrix and an iterative method. The direction of the applied external fields is parallel (anti-parallel) to the z−direction. The results reveal a significant dependence of the physical properties calculated with the deformation parameter, the dimensions of the quantum well wires and the presence or not of the impurity. The electronic transitions are in a range between 4.90 meV to 41.50 meV under the effect of the electric field, this corresponds to a range of frequencies of optical responses between 1.20 to 10 THz, that is, the mid-infrared. For the magnetic field the range is between 1.24 meV to 14 meV, that is, in frequencies from 0.36 to 3.38 THz, that is, in the far-infrared.

: The article examines the regularities of structure formation of ultrafine fibers based on poly-3-hydroxybutyrat under the influence of technological (electrical conductivity, viscosity), molecular (molecular weight), and external factors (low-molecular and nanodispersed substances of different chemical nature). Systems with polar substances are characterized by the presence of intermolecular interactions and the formation of a more perfect crystalline fiber structure. Changes in technological and molecular characteristics affect the fiber formation process, resulting in alterations in the morphology of the non-woven fabric, fiber geometry, and supramolecular fiber structure. Polymer molecular weight, electrical conductivity, and solution viscosity influence fiber formation and fiber diameter. The fiber structure is heterogeneous, consisting of both crystalline and non-equilibrium amorphous phases. This is significant in the development of matrix-fibrillar systems for drug delivery, bioactive substances, antiseptics, tissue engineering constructs, tissue engineering scaffolds, artificial biodegradable implants, sorbents, and other applications.

Cu-Sn shape-memory microwires were fabricated by a glass-coated melt spinning method. Effects of Sn content on the microstructure and mechanical property of microwires were investigated. The phase transforms from martensite to austenite with Sn content increasing from 14.0 atomic percent (at.%) to 16.5 at.%, and highly ordered intermetallic phase, δ, formed with higher Sn content. The fracture stress, σf, and the critical stress for martensitic transformation, σMs, increases with Sn content increasing. The mechanical property as well as superelasticity were improved greatly by high cooling rate of the glass-coated melt spinning method.

In light of the recent pandemic, several COVID-19 vaccines were developed, tested and approved in a very short time, a process that otherwise takes many years. Above all, these efforts have also unmistakably revealed the capacity limits and potential for improvement in vaccine production. This review aims to emphasize recent approaches for targeted rapid adaptation and production of vaccines from an interdisciplinary multifaceted perspective. Using literature research, stakeholder analysis and a value proposition canvas, we reviewed technological innovations on the pharmacological level, formulation, validation and resilient vaccine production to supply bottlenecks and logistic networks. We identified four main drivers to accelerate the vaccine product life cycle: computerized candidate screening, modular production, digitized quality management and a resilient business model with corresponding transparent supply chains. In summary, the results presented here can serve as a guide and implementation tool for flexible, scalable vaccine production to respond swiftly to pandemic situations in the future.

Given the significant role of the Ningxia Urban Agglomeration along the Yellow River in reshaping the urban network and promoting coordinated development in the upper Yellow River region of China, this paper takes enterprise flow as the explicit manifestation of the regional urban network. Based on the data of registered enterprises from 2005 to 2021, combined with the interlocking network model, social network analysis method, and spatial panel econometric model, this paper interprets the evolution of the regional urban network structure and its influencing mechanisms through the different types of enterprise flow. The results indicate the following: (1) The external network is primarily focused on outflow investments towards North China, East China, and Northwest China. The overall inflow sources form a multi-origin structure dominated by North China and East China. The Jinfeng and Xingqing serve as core hubs for enterprise exports in the external network and destinations for incoming enterprises. However, in the Productive manufacturing connections, a spatial organizational pattern driven by multiple cities has formed. (2) In the internal network, a concentric connection structure centered around the Jinfeng and Xingqing has formed. The Productive service connections are relatively active, while the Productive manufacturing connections are relatively concentrated between the Jinfeng, Xingqing, Ningdong, and Lingwu. However, there is an imbalance in the spatial connections within the urban agglomeration network and an incomplete hierarchical system of network nodes. (3) In the external network, the main feature is the absorption of external elements to foster development momentum. In the internal network, the Jinfeng and Xingqing serve as contact and radiation sources, influencing various nodes. However, their driving capacity is weak. (4) The market demand and coordinated development both demonstrate significant promoting effects on the connections within the external and internal networks. The sluggish adjustment and transformation of regional industrial structure have resulted in a temporary negative inhibitory effect on the development of transformation. The negative impact of urban investment activities and the positive impact of government management are reflected within the internal network. (5) The improvement of urban management and service functions, as well as external borrowing, can promote the connection in different network. However, the borrowing economic activity can have a negative impact in different networks. (6) Industrial agglomeration can promote enterprises connections in different networks and generate significant spatial spillover effects.

The complexity of objects and control systems increases the requirements for mathematical models. The structural identifiability (SI) assessment of nonlinear systems is one of the identification problems. Until now, this problem solves by parametric methods using various approximation methods. This approach is not always effective under uncertainty. We apply an approach to SI estimation based on the analysis of virtual structures. The requirements form for the system input based on the expansion of the excitation constancy property and S-synchronizability. The approach generalization to structural identifiability used in the analysis of systems with symmetric nonlinearity is given. homothety and identifiability conditions for systems with non-symmetric nonlinearities (SNN) obtained. The detectability and recoverability proofed for virtual frameworks (VF) guaranteed the SI estimation under uncertainty. The conditions under which the non-symmetric nonlinearity is hypothetical symmetric nonlinearity obtained. SI estimation examples considered for closed nonlinear systems under uncertainty.

A series of water diversion projects to address the uneven distribution of water resources in China involve the construction of a large number of hydraulic tunnels. As the lining structure that maintains the stability and durability of the tunnels, it is prone to durability damage during the operation process, which in turn affects the water transmission safety and water supply capacity. Therefore, it is important to evaluate the durability of hydraulic tunnel lining structure. Considering the randomness and fuzziness of the factors affecting the durability of hydraulic tunnel lining structure, this paper proposes a comprehensive evaluation model based on the coupling of set-pair analysis and extension. The G1 method and the simple correlation function method are used to determine the subjective and objective weights of the evaluation indexes respectively, and the combination weight is assigned based on the principle of minimum entropy; the set-pair analysis principle is used to establish the linkage affiliation function, calculate the comprehensive linkage affiliation of the object to be evaluated, and the maximum affiliation principle is used to judge the durability level of the hydraulic tunnel lining structure. Finally, taking a section of hydraulic tunnel as an example, the model proposed in this paper is used to calculate its durability grade as Class III, with the set-pair potential SHI(H) = 7.5856, which is consistent with the actual engineering practice, and a comparative study is done in combination with the AHP-Extenics method. It is verified that the evaluation model can scientifically and reasonably evaluate the durability of hydraulic tunnel lining structure, providing a basis for subsequent maintenance and reinforcement.

We summarize the results on electron transport in hybrid superconducting S/B/S' mesa-structure consisted of the oxide epitaxial S/B heterostructures, where S is the cuprate YBa2Cu3O 7-x superconductor, B – an interlayer with the spin dependent characteristics, and S’ is the Nb top superconductor. Josephson effect was observed manifested in appearance of oscillating Shapiro steps amplitudes with microwave signal power due to synchronization of junction self-generation of electromagnetic radiation and the external microwave probe signal. Triplet component of superconducting correlations emerged when the interlayer comprised two magnetic materials SrRuO3 and La0.7Sr0.3MnO3 with non-collinear magnetizations as well in the case of antiferromagnetic insulator Sr2IrO4 characterized by strong spin-orbit interaction. Thickness of the interlayer in the both cases considerably exceeded the coherence length of the magnetic spin active interlayer hinting on appearance of long-range proximity effect and spin-triplet superconducting current. Magnetic field dependences measured at dc, and the existence of the second harmonic in superconducting current–phase relation revealed by measurements at microwave frequencies will be discussed.

The presented research article shows a functionally graded lattice as an infill structure in designing a 3D printed mechanical element—a bicycle crank arm. The authors want to answer the fundamental question: whether the functionally graded lattice structures can efficiently improve structural performance and how they can be implemented in real complex components. Intuitively, everyone senses that using such elements must bring profit. A good example might be nature, which commonly reaches for such a solution in the skeletons of animals and humans. Two aspects determine their realisations: the lack of adequate construction and analysis methods and the limitations of existing manufacturing methods. Thus, the authors used relatively simple crank arm design and design exploration methods for structural analysis. The design exploration method enabled us to find the optimum solution efficiently. A developed prototype was created utilising additive manufacturing. One of the 3D printing methods - fused filament fabrication technology for metals, allowed the prototype of a crank arm with the optimised infill to be made. As a result, the authors developed a lightweight and manufacturable crank arm showing the new construction and analysis method implementable in similar 3D printed elements.

Metal-organic frameworks (MOFs), composed of metal nodes and inorganic linkers are promising for a wide range of applications due to their unique periodic frameworks that can be flexibly tuned. Understanding of the structure-activity relationships can facilitate the development and application of MOFs nanomaterials. Transmission electron microscopy (TEM) is a one-of-a-kind technique capable of characterizing MOFs microstructures at the atomic scale. Besides, in-situ TEM set-ups make it possible to direct visualize the microstructural evolution of MOFs in real time, which enables monitoring transitions of MOFs during growth as well as under working conditions. However, MOFs are so sensitive to the high-energy electron beam which makes TEM-based characterizing methods challenging. In this review, we first introduce the main damage mechanisms for MOFs under electron beam irradiation and two strategies to minimize the damages: low-dose TEM and cryo-TEM. Then, we discuss the techniques combined with the two strategies to analyze the MOFs’ microstructure, including three-dimensional electron diffraction, direct detection electron counting camera, and iDPC-STEM. Groundbreaking milestones and research advances with respect to static characterization of MOFs structures are highlighted. In-situ TEM studies are exemplary reviewed to provide insights into MOFs dynamics induced by various stimuli. Additionally, perspectives on promising techniques that may further facilitate the MOFs study using TEM are analyzed.

A time interval only description necessarily needs its own independent definitions, without one moment time coordinates to it. In this paper derived are time interval only set properties, including commutation relations, addition, multiplication and derivatives. Time interval only set commutation relations, consistent with one moment time set properties, are introduced by defining correspondence relations for these sets. Time development and equilibrium within the time interval description depend on the well-known ‘mean velocity theorem’ and the time interval version of the Legendre transform. In contrast, usually applied is only the traditional vector and one moment time coordinate kinematic approach from Newton’s laws. The main results of this paper are correspondences and time interval only set commutation relations. All other properties are derived from these results, while for the time interval only set, different from the one moment time set the canonical property is not valid. The time interval only description can be applied assuming spherical symmetric star-source radiation propagation, with finite time intervals for realistic measurement events. From time development with (a-)symmetry of time intervals, and from Curie’s principle, change can be described with a set theoretic approach. Time interval only set properties include the time interval only version of Noether charges and structure constants. A time interval only description for wave propagation, including group-velocity, for zero and non-zero mass wave particles, relates to the properties of the time interval only set. A second result in terms of the time interval only description is propagation wave energy equivalence with gravitation energy, derived from time interval only set commutation relations. A time interval approach, however including one moment time description dependence, was introduced in earlier publications of this author. In part 1 investigated are the time interval only set and its properties, a forthcoming part 2 to application of the time interval only description to specific groups of stars as emission sources.

Thrombosis has threatened human health in past decades. Bacillus nattokinase is a potential thrombolytic drug without side-effect and low cost and has been introduced into the consumer market as a functional food or dietary supplement. This review firstly summarizes the biodiversity sources and fermentation process of nattokinase, and systematically expounds the structure, cata-lytic mechanism and enzymatic properties of nattokinase; In view of the problems of low fermen-tation yield, insufficient activity and stability of nattokinase, this review discusses the heterologous expression of nattokinase in different microbial hosts, and summarizes the protein and genetic en-gineering progress of nattokinase-producing strains; Finally, this review summarizes the clinical application of nattokinase.

In arXiv:2111.15017v1 [1], Dias and Salamat posted some of the measured data for ac magnetic susceptibility of carbonaceous sulfur hydride, a material that was reported in Nature 586, 373 (2020) [2] to be a room temperature superconductor. They provided additional measured data in arXiv:2111.15017v2 [3]. Here I provide an analysis of these data. The results of this analysis indicate that the claim of ref. [2] that magnetic susceptibility measurements support the conclusion that the material is a room temperature superconductor is not supported by valid underlying data.

Recent expansion in data sharing has created unprecedented opportunities to explore structure-function linkages in ecosystems across spatial and temporal scales. However, characteristics of the same data product, such as resolution, can change over time or spatial locations, as protocols are adapted to new technology or conditions, which may impact the data’s potential utility and accuracy for addressing end user scientific questions. The National Ecological Observatory Network (NEON) provides data products for users from 81 sites and over a planned 30-year time frame, including discrete return Light Detection and Range (LiDAR) from an airborne observatory platform. LiDAR is a well-established and increasingly available remote sensing technology for measuring three-dimensional (3D) characteristics of ecosystem and landscape structure, including forest structural diversity. The LiDAR product that NEON provides can vary in point density from 2 – 25+ points/m² depending on instrument and acquisition date. We used NEON LiDAR from five forested sites to (1) identify the minimum point density at which structural diversity metrics can be robustly estimated across forested sites from different ecoclimatic zones in the USA and (2) to test the effects of variable point density on the estimation of a suite of structural diversity metrics and multivariate structural complexity types within and across forested sites. Twelve out of sixteen structural diversity metrics were sensitive to LiDAR point density in at least one of the five NEON forested sites. The minimum point density to reliably estimate the metrics ranged from 2.0 to 7.5 pt/m^2, but our results indicate that point densities above 7-8 pt/m² should provide robust measurements of structural diversity in forests for temporal or spatial comparisons. The delineation of multivariate structural complexity types from a suite of 16 structural diversity metrics was robust within sites and across forest types for a LiDAR point density of 4 pt/m² and above. This study shows that different metrics of structural diversity can vary in their sensitivity to the resolution of LiDAR data and users of these open-source data products should consider the point density of their data and use caution in metric selection when making spatial or temporal comparisons from these datasets.

The General Theory of Information (GTI) tells us that information is represented, processed and communicated using physical structures. The physical universe is made up of structures combining matter and energy. According to GTI, “Information is related to knowledge as energy is related to matter.” GTI also provides tools to deal with transformation of information and knowledge. We present here, the application of these tools for the design of digital autopoietic machines with higher efficiency, resiliency and scalability than the information processing systems based on the Turing machines. We discuss the utilization of these machines for building autopoietic and cognitive applications in a multi-cloud infrastructure.

Modelling errors, robust stabilization/tracking problems under parameter and model uncertainties complicate the control of the flexible underactuated systems. Chattering-free sliding-mode based input-output control law realizes robustness against the structured and unstructured uncertainties in the system dynamics and avoids excitation of unmodeled dynamics. The main purpose is to propose a robust adaptive solution for stabilizing and tracking direct-drive (DD) flexible robot arms under parameter and model uncertainties, as well as external disturbances. A lightweight robot arm subject to external and internal dynamic effects was taken into consideration. The challenges are compensating actuator dynamics with the inverter switching effects and torque ripples, stabilizing the zero dynamics under parameter/model uncertainties and disturbances while precisely track the predefined reference position. The precise control of this kind of system demands an accurate system model and knowledge of all sources that excite unmodeled dynamics. For this purpose, equations of motion for a flexible robot arm were derived and formulated for the large motion via Lagrange’s method. The goals were determined to achieve high-speed, precise position control, and satisfied accuracy by compensating the unwanted torque ripple and friction that degrades performance through an adaptive robust control approach. The actuator dynamics and their effect on the torque output were investigated due to the transmitted torque to the load side. The high-performance goals, precision&robustness issues, and stability concerns were satisfied by using robust-adaptive input-output linearization-based control law combining chattering-free sliding mode control (SMC) while avoiding the excitation of unmodeled dynamics.

Pd-Pt catalysts supported on carbon preheated to 1600°C have been reinvestigated in CHFCl2 hydrodechlorination. An additionally adopted catalyst oxidation at 350-400°C produced an order of magnitude increase in the catalytic activity of Pd/C. This increase is not caused by changes in metal dispersion or possible decontamination of the Pd surface from superficial carbon, but rather by unlocking the active surface, originally inaccessible in metal particles tightly packed in the pores of carbon. Burning carbon from the pore walls attached to the metal changes the pore structure, providing easier access for the reactants to the entire palladium surface. As upon calcination the performance of the rest of the Pd-Pt/C catalysts changes less than for Pd/C, the relation between the turnover frequency and alloy composition does not confirm the Pd-Pt synergy invoked in our previous work. The use of even higher-preheated carbon (1800°C), completely free of micropores, results in a Pd/C catalyst that does not need to be oxidized to achieve high activity and excellent selectivity up to CH2F2 (>90%).

A new strategy to nanoengineer gold/fluorocarbon multilayer (ML) nanostructures is reported. We have investigated the morphological changes occuring at the metal-polymer interface in multilayer structures with varying volume fraction of gold (Au) and the kinetic growth aspect of the microscale properties of nano-sized Au in plasma polymer fluorocarbon (PPFC). Investigations were carried out at various temperatures and annealing time by means of grazing incidence small-angle and wide-angle X-ray scattering (GISAXS and GIWAXS). We have fabricated a series of multilayers with variying volume fraction (0.12, 0.27, 0.38) of Au and bilayer periodicity in ML structure. They show an interesting granular structure consisting of nearly spherical shaped nanoparticles within the polymer layer. The nanoparticle (NP) morphology changes due to the collective effects of NPs diffusion within ensembles in the in-plane vicinity and inter-layer with increasing temperature. The in-plane NPs size distinctly increases (from 1.9 to 4 nm) with increasing temperature. The NPs become more spherical thus reducing the surface energy. Linear growth of NPs with temperature and time shows diffusion-controled growth of NPs in the ML structure. The structural stability of the multilayer is controlled by the volume ratio of the metal in polymer. At room temperature UV-Vis shows a blueshift of the plasmon peak from 560 nm in ML Au/PTFE_1 to 437 nm in Au/PTFE_3. We have identified the fabrication and post-deposition annealing conditions to limit the Local Surface Plasmon resonance (LSPR) shift (from 〖∆λ〗_LSPR=180 nm (Au/PTFE_1) to 〖∆λ〗_LSPR=67 nm (Au/PTFE_3 ML)) and their optical response over a wide visible wavelength range. A variation in the dielectric constant of the polymer in precence of varying Au inclusion is found to be the main factor affecting the LSPR frequency. Our finding may provide insights in Nano engineering ML structure can be useful to systematically control the growth of NPs in polymer matrix.

Materials design for processing and application requires fundamental understanding of their properties based interatomic interaction. The use of the novel concept of total bond order density (TBOD) as a single quantum mechanical metric to characterize the internal cohesion of a crystal and correlate with the calculated physical properties is particularly appealing. This requires detailed first-principles calculation of the electronic structure, interatomic bonding and related properties. In this article, we use this new concept and apply it to chalcogenide crystals based on data obtained from 25 crystals: Ag₂S, Ag₂Se, Ag₂Te, As₂S₃, As₂Se₃, As₂Te₃, As₄Se₄, Cu₂S, Cu₂Se, Cu₂Te, Cu₄GeS₄, Cu₂SnS₃, Cu₂SnSe₃, GeS₂, GeSe₂, Ge₄Se₉, Sb₂S₃, Sb₂Se₃, Sb₂Te₃, SnS, SnSe, CdSe, CdTe, ZnSe, and ZnTe. Together with the calculated optical and mechanical properties, we demonstrate the efficacy of using this novel approach for materials design that could facilitate the exploration and development of new chalcogenide crystals and glasses. Moreover, the TBOD and its partial components (PBOD) could be the key descriptors in machine learning protocol for broader scale design when a large database is available.

In the work, the nuclei structure was modeled by a system of shells consisting of combinations of spherical and annular vortices. Having connected the spin and the magnetic moments of the nuclei with the dynamics of the outer shell of the nucleus, we determined its type and carried out a semiempirical calculation of the parameters of its structure for stable and unstable nuclear isotopes in the sequence of the order number Z from 1 to 37. Comparison of the obtained nuclear sizes with the radii of the electron shells of atoms made it possible to reveal a definite correlation. On the basis of it, it was concluded that the periodic law of Mendeleyev can determine the patterns in the change in the structure of the atomic nucleus.

A common task in the immunodetection of structurally close compounds is to analyze the selectivity of immune recognition: it is required to understand the regularities of immune recognition and to elucidate the basic structural elements which provide it. Triazines are compounds of particular interest for such a research due to their high variability and the necessity of their monitoring to provide safety of agricultural products and foodstuffs. We evaluated the binding of 20 triazines with polyclonal (pAb) and monoclonal (mAb) antibodies obtained using atrazine as the immunogenic hapten. A total of >3000 descriptors was used in QSAR analysis of binding activities (pIC50). Comparison of the two enzyme immunoassay systems showed that the system with pAb is much easier to describe using 2D QSAR methodology, while the system with mAb can be described using the 3D QSAR COMFA. Thus, for the 3D QSAR model of the polyclonal antibodies, the main statistical parameter q² (‘leave-many-out’) is equal 0.498, and for monoclonal antibodies q² is equal 0.566. Obviously, in the case of pAb, we deal with several targets, while in the case of mAb the target is one, and therefore it is easier to describe it using specific fields of molecular interactions distributed in space.

In this review, severe plastic deformation (SPD) is considered as a materials processing technology. The deformation mode is the principal characteristic differentiating SPD from common forming operations. For large plastic strains, deformation mode depends on the distribution of strain rates between continuum slip lines and can be varied from pure shear to simple shear. A scalar, invariant and dimensionless coefficient of deformation mode is introduced as a normalized speed of rigid rotation. On this basis, simple shear provides the optimum mode for structure modification and grain refinement whereas pure shear is "ideal" for forming operations. Special experiments and SPD practice confirm this conclusion. Various techniques of SPD are classified and described in accordance with simple shear realization or approximation. It is shown that correct analyses of the processing mechanics and technological parameters are essential for comparison of SPD techniques and the development of effective industrial technologies.

Antimony (Sb) Substitution less than 10 % is examined on a single crystal of a layered superconductor NdO_0.7F_0.3BiS₂. Superconducting transition temperature of the substituted samples decreases with increasing Sb concentration. A lattice constant along the c axis showed a large decrease compared with that along the a axis. Since in-plane chemical pressure monotonically decreases with increasing Sb concentration, the suppression of the superconductivity is well described in terms of the decrease in in-plane chemical pressure.

Predicting the growth response of seedlings from the environmental responses of photosynthesis and metabolism may be improved by considering the dynamics of non-structural carbohydrate, NSC, over a diurnal cycle. Attenuation of growth metabolism when NSC content is low could explain why some NSC is conserved through the night. A dynamic model, incorporating diurnal variation in NSC, was developed to simulate growth of seedlings hour-by-hour. I compared predictions of this model to published growth and NSC data for seedlings that varied according to temperature, light, day length, or CO₂. Prolonged-darkness experiments showed a temperature dependent upper limit on the respiration capacity. Respiration was attenuated as NSC was depleted. Furthermore, when NSC was high at dawn, inhibition of photosynthesis could attenuate the accumulation of NSC under low temperature, or high light, or high CO₂. These concepts were used to simulate plant metabolism and growth rates and diurnal variation of NSC in tomato seedlings under two light levels and various temperatures. Comparison of other results using the same model parameters showed the dynamic model could predict results for starch and starch-less plants, and when growth was affected by CO₂ enrichment and day length.

An in vitro medium-throughput screen using M. tuberculosis H37Rv was employed to screen an in-house library of structurally diverse compounds for antimycobacterial activity. From this initial screen, eleven 7-substituted coumarin derivatives with confirmed monoamine oxidase-B and cholinesterase inhibitory activities, demonstrated growth inhibition of more than 50% at a 50 µM concentration. This prompted further exploration of all the 7-substituted coumarins in our library, nineteen in total, as potential antimycobacterial agents. Four derivatives showed promising antimycobacterial activity with MIC₉₉ values of 8.31 – 29.70 µM and 44.15 – 57.17 µM on M. tuberculosis H37Rv in independent assays using Gaste-Fe and 7H9 + OADC media, respectively. These compounds were found to bind to albumin which may explain the variations in MIC between the two assays. Preliminary antimycobacterial evaluation of moxifloxacin resistant M. tuberculosis show that these compounds are able to maintain their activity in fluoroquinolone resistant mycobacteria. Analysis of structure activity relationships for antimycobacterial versus neuronal enzyme inhibitory activity indicate that structural modification on position 4 and/or 7 of the coumarin scaffold may be utilized to improve selectivity towards either inhibition of neuronal enzymes or antimycobacterial effect. Cytotoxicity evaluations of the compounds indicate moderate cytotoxicity with slight selectivity towards mycobacteria. Further neuroprotective assays on SH-SY5Y human neuroblastoma cells indicate significant neuroprotection for selected compounds irrespective of their neuronal enzyme inhibitory properties. These coumarin molecules are thus interesting lead compounds that may provide insight into the design of new antimicrobacterial and/or neuroprotective agents.

UAV photogrammetry development during the last decade has allowed to catch information at a very high spatial and temporal resolution from terrains with very difficult or impossible human access. This paper deals with the application of these techniques to study and produce information of very extreme topography which is useful to plan works on this terrain or monitoring it over the time to study its evolution. The methodology stars with the execution of UAV flights on the cut slope studied, one with the cam vertically oriented and other at 45º respect that orientation. Ground control points (GCPs) and check points (CPs) were measured for georeference and accuracy measurement purposes. Orthophoto was obtained projecting on a fitted plane to a studied surface. Moreover, since a digital surface model (DSM) is not able to represent faithfully that extreme morphology, information to project works or monitoring it has been derived from the point cloud generated during the photogrammetric process. An informatics program was developed to generate contour lines and cross sections derived from the point cloud, which was able to represent all terrain geometric characteristics, like several Z coordinates for a given planimetric (X, Y) point. Results yield a root mean square error (RMSE) in X, Y and Z directions of 0.053 m, 0.070 m and 0.061 m respectively. Furthermore, comparison between contour lines and cross sections generated from point cloud with the developed program on one hand and those generated from DSM on other hand, shown that the former are capable of representing terrain geometric characteristics that the latter cannot. The methodology proposed in this work has been shown as an adequate alternative to generate manageable information, as orthophoto, contour lines and cross sections, useful for the elaboration, for example, of projects for repairing or maintenance works of cut slopes with extreme topography.

Tidal stream energy is a low carbon energy source. Tidal stream turbines operate in a turbulent environment, and the effect of the structure between the turbine and seabed on this environment is not fully understood. An experimental study using 1:72 scale models based on a commercial turbine design was carried out to study the support structure influence on turbulence intensity around turbine blades. The study was conducted using the wave-current tank at LABIMA, University of Florence. A realistic flow environment (ambient turbulent intensity = 11%) was established. Turbulence intensity was measured upstream and downstream of a turbine mounted on two different support structures (one resembling a commercial design, the other the same with an additional vertical element), in order to quantify any variation in turbulence and performance between the support structures. Turbine drive power was used to calculate power generation. Acoustic Doppler Velocimetry was used to record and calculate upstream and downstream turbulence intensity. In otherwise identical conditions, performance variation of only 4% was observed between two support structures. Turbulent intensity at 1, 3 and 5 blade diameters, both upstream and downstream, showed variation up to 21% between the two cases. The additional turbulent structures generated by the additional element of the second support structure appears to cause this effect, and the upstream propagation of turbulent intensity is believed to be permitted by surface waves. This result is significant for the prediction of turbine array performance.

Lomami National Park, located in the Democratic Republic of Congo, is renowned for the integrity of its forest ecosystems, safeguarded by the absence of agricultural activities and limited road access. However, these ecosystems remain under-researched, particularly regarding forest cover dynamics. This research gap poses a significant challenge to establishing rigorous monitoring, which is essential for ensuring the long-term preservation of these valuable ecosystems. This study evaluates land cover dynamics within Lomami National Park through supervised classification of Landsat images from 2008, 2016, and 2024. Seven spatial structure indices were calculated to highlight the dynamics of landscape composition and configuration, distinguishing between the park's core and buffer zones. The underlying spatial transformation processes were identified using a decision tree approach. The results highlight a striking contrast in forest cover stability between Lomami National Park and its surrounding periphery. Within the park, forest cover has not only been preserved but has also shown a modest increase, rising from 92.60% to 92.75%. In contrast, the peripheral zone experienced a significant decline in forest cover, decreasing from 79.32% to 70.48% over the same period. This stability within the park goes beyond simply maintaining forested areas; it includes the preservation and strengthening of the spatial structure of forest ecosystems. For instance, edge density, which is a key indicator of forest edge compactness, remained stable in the park, fluctuating between 8 m/ha and 9 m/ha. However, in the peripheral zone, edge density exceeded 35 m/ha, suggesting that forest edges in the park are considerably more cohesive and intact than in the surrounding areas. Furthermore, the spatial transformation processes within each area underscore these contrasting dynamics. In the park, the main process was aggregation of primary forest patches, which reflects a trend toward continuous and connected forest landscapes. By contrast, the peripheral zone experienced dissection, indicating fragmentation and breakdown of forest patches. Together, these findings underscore the park's role in maintaining both the extent and the structural integrity of forest ecosystems, setting it apart from the more degraded periphery. These findings highlight not only the resilience of forest ecosystems in the face of limited anthropogenic pressures but also the crucial importance of effective land management and rigorous conservation strategies in addressing the challenges of urbanization and surrounding rural expansion. They further emphasize that well-adapted conservation measures, combined with specific demographic and socio-economic conditions, can play a pivotal role in long-term forest preservation and ecological stability.

Background: Interleukin-6 is dysregulated in multiple pathological conditions, e.g. cancer and inflammatory diseases. Aim: To investigate new mechanisms for regulation of pathological IL-6 production. Methods: PBMC produce interleukin-6 (IL-6) stimulated by cancer serum factors or specific peptides. Immunoregulatory albumin neo-structures and peptides were identified with 2D-gel electrophoresis and MALDI-TOF-MS analyses. Il-6 and albumin neo-structures were determined by ELISA. Results: Conformational changes of normal serum albumin by proteolytic degradation generates an IL-6 inducing neo-structure, IL-6 inducing factor (IL-6IF), which is immunogenic eliciting production of autoantibodies. IL-6 production induced by IL-6IF and cancer patient sera is inhibited by specific antibodies. The serum concentration of IL-6IF, is significantly higher in advanced cancer stages and its presence is significantly correlated to the survival of the patients. Conclusion: A new mechanism for induction IL-6 synthesis is presented. Based on this mechanism the pathological IL-6 production related to an enhanced proteolytic activity can be diagnosed and selectively inhibited by specific antibodies. Such antibodies have been identified and purified. Thus, the neo-structure, inducing pathological IL-6 production, associated with a reduced survival of cancer patients can be selectively removed by therapeutic administration of antibodies leaving the function of IL-6 needed for the normal activity of the immune system intact.

The iron roughneck is an automated equipment utilized for the connection and removal of drilling tools. This paper presents the design of an integrated iron roughneck, providing a detailed introduction to its clamp body structure, along with an analysis of its structural characteristics and performance requirements. The study delves into the integration mode and working characteristics of the clamping mechanism and spin buckle mechanism for the integrated upper clamp body structure of the iron roughneck. Additionally, this paper conducts an in-depth theoretical study on the spin buckle mechanism. Firstly, it analyzes the actual working condition of the spin buckle roller from two perspectives: contact theory and rolling friction theory, determining the structural form of the spin buckle roller. Secondly, it investigates the relative displacement between the spin buckle mechanism and the drilling tool, proposing a design method for the floating device mounted on the spin buckle roller and establishing the kinematic equation of the spin buckle roller under the influence of the floating device. Furthermore, the kinematic equations of the spin buckle roller under the influence of the floating device are established. Finally, a dynamics simulation experiment is performed to simulate the working process of the spin buckle mechanism under actual working conditions, analyzing the dynamics and kinematics of the spin buckle mechanism and obtaining the relevant parameter curves of the spin buckle mechanism and drilling tools. Through data comparison and analysis, the correctness of the theoretical analysis results and the rationality of the performance and structure of the spin buckle mechanism are verified.

Monitoring the integrity of aeronautical structures is fundamental for safety. Structural Health Monitoring Systems (SHMS) perform real-time monitoring functions, but their performances must be carefully assessed. In this work the damage detection performances of a strain-based SHMS, were evaluated on a composite helicopter rotor blade root. The SHMS monitored the bonding between the central core and the surrounding antitorsional layer. A damage detection algorithm was trained through Finite Element analyses performed on the component. The effects of the loads variability and of damages were decoupled by including a load recognition step in the algorithm. Load recognition was accomplished in different ways: version#1 adopted an Artificial Neural Network (ANN) trained on blades in pristine condition; version#2 was trained also on damaged blades; version#3 adopted a calibration matrix method. Anomaly detection, damage assessment, and localization were performed by using an ANN. Results showed a higher load identification and anomaly detection accuracy for version#1 and version#2 compared to version#3. Gaussian noise reduced anomaly detection and damage assessment performances, and reduced damage localization accuracy for bigger damages. The damage detection performance were obtained for a fibre optic based-SHMS, including the trade-off between probability of detection and false alarm rate for different damage sizes.

Transformation formula under the action of a general linear fractional transformation for generalized Dedekind eta-function has been a subject of intensive study, Rademacher, Dieter, Meyer et al. However, the (Hecke) modular relation structure has not been recognized until the work of Goldstein-de la Torre, and streamlining the classical proofs in the modular relation will reveal the meaning hidden in those works. Our main aim is to elucidate the works of these researchers in the context of modular relations.

This paper proposes a lightweight joint with bamboo culm cross connection, which is constructed by screwing one side of the screw into the other side of the wooden plug, its simple construction makes it easy to manufacture and cost-effective. This form connects adjacent bamboo culms to form corner joints, and bolt connects adjacent bamboo culm frames to form edge joints, to explore the mechanical properties of the combination joints formed by corner joints and edge joints, by combining experiments and numerical simulations, the method discovered and explained the relationship and mechanism between the number and position of bolts and the stiffness of edge joints. A calculation model for frame-unit bamboo culm members considering semi-stiffness of joints is proposed, and the conversion equations between linear stiffness of corner and edge joint and their rotational stiffnesses are derived. By establishing the series and parallel relationship between the corner and edge joints in the assembled members, a generalized relational equation between the total stiffness of the assembled joint and the stiffness of the corner and edge joints is derived. A numerical simulation method for frame-unit bamboo culm members with semi-rigid joints is proposed, which can obtain the stiffness calculation formula of edge joints and the average rotational stiffness value of semi-rigid corner joints. A finite element analysis method based on semi-rigid joints is proposed for frame-unit bamboo culm members, and the internal force sketches and calculation methods for bamboo culms and joints are presented, which can be used for the internal force analysis and design of frame-unit bamboo culm lattice structures.

Chitosan (CS) nanoparticles are under investigation for a wide range of applications in nanomedicine. The structural, molecular and physicochemical properties of chitosan nanoparticles have a direct bearing on their efficacy in drug conjugation and delivery, gene delivery, and tissue engineering. Herein we report on the structural, morphological and molecular properties of chitosan nanoparticles synthesized using the ionic gelation method with the intended purpose of being used for drug delivery. The chitosan nanoparticles (CS-NPs) were prepared in the 0.25 to 1.0% w/v concentration range, whereas separate samples of the 1.0% w/v CS-NPs were also functionalized with polyethylene oxide (PEO) alone and with a diblock copolymer of PEO and polypropylene glycol (PPG). The average size of the CS-NPs was determined from TEM imaging to be in the range of 11.3 to 14.8 nm. The XRD and TEM analyses show that the CS-NPs have semi-crystalline structure with the degree of crystallinity depending upon the nature of synthesis. Our results show that functionalizing the 1.0% w/v CS-NPs with PEO increases the degree of crystallinity whereas functionalizing with the diblock copolymer PEO - PPG results in a significant increase in their degree crystallinity. The CS/TPP concentration (CS:TPP fixed at 1:1 ratio) had no apparent effect on the degree of crystallinity of the CS-NPs. The results from the FTIR analysis confirm incorporation of TPP with CS in the CS-NPs. Additionally, FTIR analysis shows an enhancement of hydrogen bonding that is consistent with the increase in the degree of crystallinity of the CS-NPs.

The Universe is treated as an unbound thermodynamic system in which two forces of Nature compete: Attractive gravity loss and repulsive entropic gain. Entropic gain, although not presently considered a force of Nature, is otherwise well known and can be expressed with the gas laws. The Universe at the time of last scattering was all gas. Its instant gain is expressed as gas pressure. When the Gibbs equation is properly applied to this unbound gas, the resulting atomic Hubble parameter is found to be exclusively dependent on baryon density, giving a constant and perpetual two-to-one gain/loss ratio. Instant loss to gravity cannot offset gas pressure in this “thermal equation”. By contrast, the Friedmann equation, a ΛCDM foundation, treats baryon mass as accreted, having little if any entropic gain. These two equations are actually equivalent. Expanding accreted matter at its comoving critical density is herein shown to behave exactly like a freely expanding gas. However, neither equation includes all of today’s Universal kinetic energy, and cannot by themselves fully account for observed stellar movement. The present paper proposes the plausible existence of highly energetic or “suprathermal” free electrons which comprise about half of the intergalactic medium’s kinetic total. It is this suprathermal energy which Λ expresses. The fluid equation, another ΛCDM foundation, eliminates entropic gain from the Gibbs equation. Additionally, rest mass’s Einstein energy E=Mc² is treated as a thermal variable. These two assumptions, isoentropy and energy conflation, led astronomers to populate Λ as they followed the prior art.

Electrospun fiber scaffolds are widely used in small diameter vascular tissue engineering because they mimick organizational structure and biological function of natural extracellular matrix. However, there is still one problem of low patency rate in the long term. The main reasons are the mismatch of compliance and the easy formation of thrombus. Therefore, it is very important to promote the rapid endothelialization of small diameter tissue engineering blood vessels by regulating the topological structure and biological properties of electrospun fiber scaffolds. Firstly, crimped polylactic acid (PLA) fibers were prepared by heat treatment to mimick the crimped structure and nonlinear mechanical properties of the elastic membrane of blood vessel wall. It improved effectively the aspect ratio of human umbilical vein endothelial cells (HUVECs) and promoted lateral alignment and growth. Then, crimped PLA fibers with three levels of pore structure were prepared by thermal induced phase separation, vapor induced phase separation and laser ablation to enhance the degree of HUVECs infiltrarion and realize patterned cell growth. Crimped PLA fibers with three levels of pore structure promote rapid endothelialization of blood vessels, which is of great significance to achieve long term patency rate of small diameter tissue engineering blood vessels.

Interior permanent magnets motors are widely used in applications requiring high power den-sity and high efficiency due to their high torque generating capabilities. Recently, given the re-cent price fluctuations and unstable supply of rare-earth permanent magnets, alternative config-urations with reduced use of permanent magnets are being sought. Among the various candi-dates related to this, the consequent-pole type rotor structure can halve the number of perma-nent magnets used compared with conventional structures. However, in the no-load analysis, the waveform of the back electromotive force becomes asymmetric, generating a harmonic component. As a result, there is a disadvantage that the torque ripple increases. To overcome these shortcomings, we propose a novel rotor structure that applies a consequent-pole structure to an embedded permanent-magnet motor structure, wherein a number of permanent magnets are arranged in a flared structure to constitute a single polarity. In the proposed flared-structured magnet arrangement, it is possible to adjust the angle of the permanent magnet and the polar angle to mitigate the asymmetry of the back EMF waveform. The proposed struc-ture was optimized with a genetic algorithm and a prototype of the optimal model was con-structed and experimentally evaluated to verify its validity. Finally, the performance improve-ment and validity of the proposed structure were verified by comparing the analysis results of the optimal model with the experimental results.

A novel quasi-twisted miniaturized wideband Branch Line Coupler (BLC) is proposed. The design is based on bisecting the conventional microstrip line BLC transversely and folding bisected sections on double-layered substrates with a common ground plane in between. The pair of quarter wavelength horizontal parallel arms is converted to a Z-shape meandered microstrip line in the designed structure. On the other hand, the pair of quarter wavelength vertical arms are cut by half into two lines and converted to a periodically loaded slow wave structure. The bisected parts of BLC are placed on the opposite side of the doubled-layer substrate and connected through four vias passing through the common ground plane. This technique enabled a compact BLC size of 6.4×18 mm2, which corresponds to a surface area miniaturization by ~50% as compared to the classical BLC size of 10×23 mm2 at 6GHz, Moreover, the attained relative bandwidth is 73.9% (4.6-10 GHz) for S11, and 75.8% (4.5-10 GHz) for S33 as compared to 41% for the ordinary BLC at the same resonant frequency. The circuit is constructed on a double-layered low-cost FR4 substrate with a relative permittivity of 4.3, and a loss tangent of 0.025. An isolation of -13dB was realized in both S13 and S31 demonstrating an excellent performance. The transmission coefficients between input/output ports S21, S41, S23, and S43 are between -3.1dB to -3.5dB at the frequency of 6GHz. Finally, the proposed BLC provides phase differences between output ports of 90.5o and 94.8o at the frequency of 6GHz when the input ports 1 and 3 are excited, respectively. The presented design offers the potential of being utilized as a unit cell for building a Butler-matrix (BM) for sub-6GHz 5G beamforming networks.

Empirical equations representing, interpolating and smoothing groups of measurement results by regression methods are in widespread use in metrology and other fields of science and engineering. Standard equations for the propagation of measurement uncertainties to values computed from such equations are available but suffer from a lack of general acceptance and are only infrequently applied in practice. One reason for the slow uptake is the lack of clear methods to account for systematic error. In this paper, uncertainty propagation equations in terms of covariance matrices are generalized to allow for systematic errors in least-squares regression, and effects of the resulting uncertainties are investigated analytically. A stochastic ensemble model of systematic error is proposed for the computation of the non-diagonal elements of the weight matrix of the Generalized Least-Squares method (GLS) from the measurement uncertainty. A GLS projector formalism is described which separates the effects of measurement scatter on values calculated by the equation from those on the related “residuals”, i.e., the residual errors in the fitted data. The same projectors act similarly on the associated uncertainties and covariance matrices and permit the effects of systematic errors on the simulation covariance to be quantified. It is demonstrated that, in order to include systematic errors in the uncertainty estimates of GLS, covariance matrices may be substituted by novel, specifically defined dispersion matrices that are not specified yet by the GUM[1]. Systematic measurement errors may be estimated from various sources; a particularly easy way suggested here involves analyzing the structure in the regression residuals. It is demonstrated that GLS projectors exhibit inherent features of “error blindness” also with respect to systematic errors. [1] GUM: Guide to the Expression of Uncertainty in Measurement, http://www.bipm.org/en/publications/guides

During the last decades the quantitative description of electrical and magnetotransport properties of solid-state materials has been a remarkable challenge in materials science. Recently, the discovery of a novel class of materials, the topological semimetals, has led to a growing interest for the full understanding of their magnetotransport properties. In this review, the strong interplay among topology, band structure and carrier mobility in recently discovered high carriers mobility topological semimetals is discussed and their effect on their magnetotransport properties is outlined. The huge magnetoresistance effect, especially in the Hall transverse configuration, and a new version of a three-dimensional quantum Hall effect observed in high-mobility Weyl and Dirac semimetals are reviewed. The design of novel quantum sensors based on solid-state semimetals is also encouraged.

The discovery of solitonlike coherent structure (SCS) in boundary layer flows is crucial for understanding turbulence origins and in particular for laminar-turbulence transition. However, the task of finding solutions for solitonlike coherent structure from the Navier-Stokes equations poses a significant challenge. In this paper, based on the author's previous work [B.H. Sun, Exact similarity solutions of unsteady laminar boundary layer flows, Preprints 2023, 2023092117], we are able to study convergent flow boundary layers, whose solution encompasses both shock wave and solitary wave solutions, and their superposition gives rise to solitary-like waves, namely solitonlike coherent structure. It is found that the solitonlike coherent structure can only be obtained by combining the Navier-Stokes equations and mass conservation, since the combined equations will have the third order derivatives respect to coordinate $x$, in other words, without the mass conservation condition, the Navier-Stokes equations does not contain solitonlike coherent structure by itself. Finally proved solitonlike coherent structure is a universal motion form of viscous fluid.

Several mathematicians and physicists are working all over the globe to get a unified theory. However, most of them are discarding Einstein’s view at the very first step of their theories. This article provides a brief description about this. Also, on the basis of Koga’s theory we point out two reasons which might have caused Einstein’s failure to get a unified theory.

The tension cable-supported power transmission structure (TC-PTS) is a new type of power transmission structure suitable for mountainous terrain, which is sensitive to wind load. In this regard, a nonlinear finite element analysis model of wind-induced vibration is proposed for the TC-PTS, and the wind-induced vibration response of the structure is analyzed. Firstly, the tangent stiffness matrix of the three-dimensional truss element for the supporting suspension cable and transmission line, considering the geometric nonlinearity of structures, is derived through the relationship between the element elastic energy and its displacement. Subsequently, the element mass matrix and damping matrix of the supporting suspension cable and transmission line, as well as the element nodal load vector obtained from wind load equivalence are given. Then, based on the nonlinear finite element theory, the nonlinear dynamic equation of wind-induced vibration is established for the TC-PTS and solved by Newmark-β method combined with Newton-Raphson iterative method. Furthermore, the rain-flow counting method and Miner's linear fatigue cumulative damage theory were used for wind induced fatigue damage assessment. Finally, a two-span TC-PTS is selected as an example, and the wind-induced nonlinear vibration and fatigue damage assessment are analyzed through the proposed model. The results show that the proposed model has high computational accuracy and efficiency. With the increase of wind speed and wind direction angle, the maximum lateral displacement and tension of the supporting suspension cable and transmission line increase, and their degree of increase shows a nonlinear trend. In terms of the wind-induced fatigue analysis results of TC-PTS, the fatigue damage at the end of the supporting-conductor suspension cable is greater than the fatigue damage at its midpoint. Compared to the fatigue damage at the midpoint of the conductor, the fatigue damage at the end of the conductor is less affected by wind direction angle, and both are more significantly affected by the wind speed.

In this work, three different types of sandwich structures were manufactured using Formica sheet (a paper-based sheet) as skin and perlite/sodium silicate foam as core with/without the paper honeycomb. The sandwich structures were fabricated by attaching Formica sheets on both sides of the honeycomb, perlite/sodium silicate foam, and perlite/sodium silicate foam-filled honeycomb core panels. The flexural characteristics were studied by a three-point bending test and the thermal conductivity was measured using Lee’s thermal conductivity apparatus. The results demonstrated a significant improvement in flexural properties, including core shear stress, facing stress, bending stress, and energy absorption, when incorporating the paper honeycomb reinforcement. The thermal conductivity and flexural properties were found to be well-compatible with the existing building materials for similar applications in the literature. The failure investigation revealed that the sandwiches with paper honeycomb only prematurely failed due to core buckling, whereas the foam-filled honeycomb core-based sandwiches were able to sustain higher loads, exhibiting material failures such as core shear failure, skin rapture, and delamination. It is found that the foam-filled paper honeycomb sandwich structures can withstand higher bending loads compared to foam core-based and paper honeycomb-based sandwich structures. These developed sandwiches offer potential as green materials due to the characteristics of their constituent materials and can find valuable applications in the building thermal insulation.

This paper delves into the dynamics of asset pricing within Bachelier’s market model (BMM), elucidating the representation of risky asset price dynamics and the definition of riskless assets. It highlights the fundamental differences between BMM and the Black-Scholes-Merton market model (BSMMM), including the extension of BMM to handle assets yielding a simple dividend. Our investigation further explores Bachelier’s term structure of interest rates (BTSIR), introducing a novel version of Bachelier’s Heath-Jarrow-Morton model and adapting the Hull-White interest rate model to fit BMM. The study concludes by examining the applicability of BMM in real-world scenarios, such as those involving environmental, social, and governance (ESG)-adjusted stock prices and commodity spreads.

The layout of deep chamber for coal-gangue separation (DCCS) based on the horizon of the weak stratum can affect the stability of its surrounding rocks. First, the work summarized the main structural characteristics of DCCS. Similar simulation tests were performed to analyze the deformation and failure law of surrounding rocks of DCCS under different horizons of the weak stratum. Then, 60 numerical simulation schemes were designed by considering the lateral pressure coefficient and the thickness and horizon of the weak stratum. A comprehensive evaluation method was proposed for the stability of surrounding rocks. The optimal layout methods of the DCCS were determined based on the thickness and horizon of the weak stratum in different ground stress fields. If the thickness of the weak stratum was large and lateral pressure coefficient λ < 0.6 or λ > 1, the stability of surrounding rocks was optimal to arrange the side of DCCS along the weak stratum. When 0.6 ≤ λ ≤ 1, the optimal approach for controlling surrounding rocks was to position the floor of DCCS along the weak stratum. If the thickness of the weak stratum was small and λ<0.6 or λ>1, the stability of surrounding rocks was optimal to arrange the side of DCCS near roof along the weak stratum. When 0.6 ≤ λ ≤ 1, the optimal approach for controlling surrounding rocks was to arrange the side of DCCS near the floor along the weak stratum. The results can provide an important theoretical reference for the spatial layout and support design of DCCS.

This paper proposes an AI-based approach to overcome the limitations of the SHM system in measuring global stress with limited sensors. Feature elements are selected based on correlation analysis among finite elements and used as stress-measured points. An ANN is used to establish the solution relationship between the feature and correlation elements. The proposed method is applied to the connector structure of an offshore platform, and an optimal ANN is established to optimize accuracy by considering factors like the number of sensors, neural network framework, and convergence criteria. The accuracy of the ANN is verified through a real-scale model test, demonstrating 93.6% accuracy. This technology represents a significant advancement, enhancing the practicality of the structural health monitoring (SHM) system from “point monitoring" to “field monitoring".

Iron-based materials are widely applied in Fenton chemistry and they have promising prospects in the processing of wastewater. The composition complexity and rich chemistry of iron and/or oxides, however, hamper the precise understanding on the active sites and the working mechanism which still remain highly controversial. Herein, iron oxides of four different model systems are designed through a conventional precipitation method plus H2 reduction treatment. These systems feature Fe@Fe3O4 with abundant oxygen vacancy, Fe0 and Fe3O4 particles with interface structures, and Fe3O4-dominated nanoparticles of different sizes. These materials are applied in the decomposition of methyl orange as a model reaction to assess the Fenton chemistry. The Fe@Fe3O4 with core-shell structures exhibited significantly higher decomposition activity than the other Fe3O4-rich nanoparticles. A thin Fe3O4 layer formed by auto-oxidation of iron particles when exposing to air can boost the activity as compared with the Fe0 and Fe3O4 particles with interface structures but poor oxygen vacancy. The unique hetero-structure with the co-existence of both metallic iron and oxygen vacancy displayed excellent redox propensity which might account for the superior Fenton activity. This finding provides a new perspective to understand and design highly efficient iron-based Fenton catalysts.

In this study composite with alternate layers of 5056 and 1580 alloys was manufactured by wire arc additive manufacturing technology. It is shown that increased strength characteristics of composite material can be obtained due to deformation treatment by high-pressure torsion (HPT) technique. The microstructure and mechanical properties of the HPT-processed material in different structural states were investigated. The HPT-processed material exhibits high value of ultimate tensile strength (~ 770 MPa) but low ductility. Short-term annealing at 250 oС and additional deformation by HPT to 0.25 of revolution at room temperature resulted in a slight decrease in material’s strength to ~ 700 MPa but provided ductility ∼ 9%. Physical mechanisms to improve plasticity in correlation with microstructure evolution is discussed.

This paper has a twofold objective. The first aim is to present a comprehensive bibliographical analysis of journal articles and book chapters on fuzzy-random option pricing (FROP) over the WoS and SCOPUS databases. It follows PRISMA criteria and takes special care of developments in continuous time. Thus, we described the principal findings about the research streams, outlets and authors of this topic and lets us suggest further research. The second contribution is motivated by the fact that the bibliographical revision has identified a lack of developments on equilibrium models on the yield curve. This question motivates extending Vasicek’s yield curve equilibrium model to introduce fuzziness in the parameters that govern interest rate movements (speed of reversion, equilibrium short-term interest rate, and volatility). Likewise, this paper develops an empirical application on the term structure of fixed income public bonds with the highest credit rating in the Euro area.

The availability of sufficient amounts of form I of benzocaine has led to the investigation of its phase relationships with the other two existing forms II and III using adiabatic calorimetry, powder X-ray diffraction, and high-pressure differential thermal analysis. The latter two forms were known to have an enantiotropic phase relationship with form III stable at low-temperature and high-pressure, while form II is stable at room temperature. Using adiabatic calorimetry data, it can be concluded, that form I is the stable low-temperature, high-pressure form, which also happens to be stable at room temperature; however, form II, due to its persistence at room temperature, is still the most convenient polymorph to use in formulations. Form III presents a case of overall monotropy and does not possess any stability domain in the pressure-temperature phase diagram. Heat capacity data for benzocaine have been obtained by adiabatic calorimetry from 11 K up to 369 K above its melting point, which can be used to compare to results from in-silico crystal structure prediction.

Five years ago, the concept of addressed fiber Bragg structures (AFBS) was proposed, which simultaneously perform the functions of a two-frequency radiation shaper, the difference frequency of which is the AFBS address, and a sensitive element, since the value of the difference frequency is invariant to measured physical fields, and the set of difference frequencies, moreover, is orthogonal in the array of such sensors, enabling their address multiplexing. In this article, we provide an overview of the theory and technology of AFBS, including the structures with three or more spectral components with various combinations of difference frequencies, symmetrical and asymmetric, performing the functions of the address and converting information signals to the low-frequency range at the same time, along with other functions. The subjects of interrogation of these structures, their fabrication and calibration are discussed as well. We also consider a wide range of applications in which AFBS can be used, covering such areas as oil and gas production, power engineering, transport, medicine, etc. In addition, the prospects of AFBS further development are proposed.

The recent covid crisis has proven important lessons for academia and industry regarding digital reorganization. Among fascinating lessons from these times is the huge potential of data analytics and artificial intelligence. The crisis exponentially accelerated the adoption of analytics and artificial intelligence, and this momentum is predicted to continue into the 2020s and over. Moreover, drug development is a costly and time-consuming business, and only a minority of approved drugs return the revenue that exceeds the research and development costs. As a result, there is a huge drive to make drug discovery cheaper and faster. With modern algorithms and hardware, it is not too surprising that the new technologies of artificial intelligence and other computational simulation tools can help drug developers. In only two years of covid research, many novel molecules have been designed/identified using artificial intelligence methods with astonishing results in terms of time and effectiveness. This paper will review the most significant research on artificial intelligence in the de novo drug design for COVID-19 pharmaceutical research.

In laser joining of copper (Cu) and aluminum (Al) sheets, the Al sheet is widely chosen as the top surface for laser irradiation because of increased absorption of laser beam and lower melting temperature of Al in contrast to Cu. This research focus on welding from Cu side to Al sheet. The main objective of irradiating the laser beam from the copper side (Cu on top) is to exploit higher solubility of Al in Cu. A significantly lower laser power can be used with 515 nm laser in comparison to 1030 nm. In addition to low laser power, a stable welding is obtained with 515 nm. Because of this advantage, 515 nm is selected for the current research. By fusion of Cu and Al the two sheet metals are welded, with presence of beneficial Cu solid solution phase and Al+Al2Cu in the joint with the brittle phases intermixed between the ductile phase. Therefore the mixed composition strengthens the joint. However excessive mixing leads to formation of more detrimental phases and less ductile phases. Therefore optimum mixing must be maintained. Energy dispersive X-ray spectroscopy (EDS) analysis indicate that large amount of beneficial Cu solid solution and Al rich phases is formed in the strong joint. From the tensile shear test for a strong joint, fracture is obtained on the heat-affected zone (HAZ) of Al. Therefore the key for welding from copper side is to have optimum melt with beneficial phases like Cu and Al+ Al2Cu and the detrimental phases intermixed between the ductile phases

For the better part of a century researchers across disciplines have sought to explain the crystallography of the elemental transition metals: hexagonal close packed, body centered cubic, and face centered cubic in a form similar to that used to rationalize the structure of organic molecules and inorganic complexes. Pauling himself tried with limited success to address the origins of transition metal stability. These early investigators were handicapped, however, by incomplete knowledge regarding the structure of metallic charge density. Here we exploit modern approaches to charge analysis to first comprehensively describe transition metal charge density. Then, we use topological partitioning and quantum mechanically rigorous treatments of kinetic energy to account for the structure of the density as arising from the interactions between metallic tetrahedra. We argue that the crystallography of the early transition metals results from charge transfer from the so called “octahedral” to “tetrahedral holes” while the face centered cubic structure of the late transition metals is a consequence of antibonding interactions that increase octahedral hole kinetic energy.

Every protein consists of a linear sequence over an alphabet of $20$ letters/amino acids. The sequence unfolds in the $3$-dimensional space through secondary (local foldings), tertiary (bonds) and quaternary (disjoint multiple) structures. The mere existence of the genetic code for the $20$ letters of the linear chain could be predicted with the (informationally complete) irreducible characters of the finite group $G_n:=\mathbb{Z}_n \rtimes 2O$ (with $n=5$ or $7$ and $2O$ the binary octahedral group) in our previous two papers. It turns out that some quaternary structures of protein complexes display $n$-fold symmetries. We propose an approach of secondary structures based on free group theory. Our results are compared to other approaches of predicting secondary structures of proteins in terms of $\alpha$ helices, $\beta$ sheets and coils, or more refined techniques. It is shown that the secondary structure of proteins shows similarities to the structure of some hyperbolic $3$-manifolds. The hyperbolic $3$-manifold of smallest volume --Gieseking manifold--, some other $3$ manifolds and the oriented hypercartographic group are singled out as tentative models of such secondary structures. For the quaternary structure, there are links to the Kummer surface.

Comparison of the influence of conditioning temperature of microspheres made of medical grade poly(L-lactide) (PLLA) and polylactide with 4wt.% of D-lactide content (PLA), on its thermal and structural properties is presented. The microspheres were fabricated by solid-in-oil-in-water method for application in additive manufacturing. The microspheres were annealed below glass transition temperature (Tg), above Tg but below onset of cold crystallization, and at two temperatures selected from the range of cold crystallization corresponding to crystallization of α’ and α form of poly(L-lactide) respectively, i.e., at 40°C, 70°C, 90°C and 120°C, in order to verify the influence of conditioning temperatures on sinterability of microspheres set as sintering window (SW). Based on differential scanning calorimetry measurements SW of microspheres were evaluated with consideration of existence of cold crystallization and reorganization of crystal polymorph. The results indicate that the conditioning temperature influence on availability and range of SW that depending on the D-lactide presence. We postulate the need for an individual approach for polylactide powders in determining the SW as a temperature range free of any thermal events. Moreover, other core powder characteristic, such as residual solvent content, morphology, particle size distribution, powder flowability and thermal conductivity, as a key property for successful laser sintering, are characterized. The microspheres are close to sphere and the size of microspheres are below 100 µm. Residual solvents content decreases with the increase of annealing temperature. The thermal conductivity is 0.073 W/mK and 0.064 W/mK for PLA and PLLA microspheres, respectively, and it depends on the spherical shape of the microspheres. Furthermore, the WAXD studies prove that an increase in the conditioning temperature causes a slight increase in crystallinity degree for PLLA microspheres and clear increase in crystallization for PLA microspheres.

Experimental evidence showed how various complex systems, characterized by a fluctuation scaling, satisfy the well-known Taylor's law. The present work aims to apply for the first time Taylor's law, given its general treatment, for a flow field at $Re$ around $10^4$, since activity of each fluid particle is highly fluctuating, especially in the context of vortex shedding. In addition, the further element of innovation is the use of an innovative thin-films based device consisting of an elastic piezoelectric flapping flag that is proposed as a measuring instrument of the flow field. The oscillations of the flapping flag, due to the vortexes release downstream to an obstacle of cylindrical shape, generate an alternating piezoelectric voltage whose time history is similar to the chaotic components of the fully developed turbulent speed. Preliminary experimental results about the use of thin-films based device in a flume channel are reported together with a second order analysis on the voltage difference and a scaling law of the exponent scale.

Traditional potential transformers have problems of large volume, difficulty in insulation, iron core saturation, ferroresonance overvoltage and poor transient response characteristics. The voltage sensor based on the principle of electric field coupling and differential input structure does not need to contact the measured object or ground, and can avoid the above problems. However, it requires a sufficiently high capacitance between the differential electrodes to obtain sufficient accuracy and a high voltage division ratio. The existing method of using mutual capacitance between the differential electrodes will cause many problems and fail to meet the practical needs. To solve the above problems, this paper innovatively uses multi-layer ceramic capacitor to replace the mutual capacitance and designs a new type of voltage sensor. In addition, by using single bypass small resistance grounding method to increase the input impedance of the differential signal processing circuit, error of the sensor is further reduced. The experimental results show that the sensor has excellent accuracy and great transient response characteristics. The ratio error under power frequency is within ±0.5% and the phase error is within 1. The ratio error in the range of 500 Hz∼30 kHz is within ±5% and the phase error is within 5. Moreover, it has the advantages of low cost, miniaturization, flexible shape and easy to adjust the voltage division ratio. These characteristics indicate that the sensor has good voltage measurement and sensor network potential.

The objective of this study was to assess the ability of producing laminated edible films manufactured using the following proteins; gelatin (G), whey protein isolate (WPI), and polysaccharide; sodium alginate (SA), and to evaluate their physical properties. Additionally, films’ preparation employing these ingredients was optimized through the addition of corn oil (O), Overall, 8-types of laminated films (G-SA, G-WPI, SA-WPI, SA-G-WPI, GO-SAO, GO-WPIO, SAO-WPIO, SAO-GO-WPIO were developed in this study. The properties of the prepared films were characterized through the measurement of; tensile strength (TS), elongation at break point (EB), puncture resistance (PR), tear strength (TT), water vapour permeability (WVP) and oxygen permeability (OP). The microstructure of cross-sections of laminated films was investigated by scanning electron microscopy (SEM). Mechanical properties of films were dramatically enhanced through the addition of film layers. GO-SAO laminate showed the best barrier properties to water vapour (22.6 ± 4.04 g mm/kPa d m2) and oxygen (18.2 ± 8.70 cm3 mm/kPa d m2). SAO-GO-WPIO laminate film was the strongest of all laminated films tested, having the highest TS of 55.77 MPa, PR of 41.36 N and TT of 27.32 N. SA-G-WPI film possessed the highest elasticity with an EB value of 17.4%.

Corona viruses hijack human enzymes to assembly sugar coat on Spike glycoproteins. The mechanism that human antibodies may uncover the antigenic viral peptide epitopes hidden by sugar coat are unknown. In this study, we analyzed recombinant SARS-CoV-2 Spike protein secreted from BTI-Tn-5B1-4 cells, by trypsin and chymotrypsin digestion followed by mass spectrometry analysis. We acquired MS/MS spectrums for glycopeptides of all 22 predicted N-glycosylated sites. We further analyzed the surface accessibility of Spike proteins according to Cryo-EM and homolog-modeled structures, and available antibodies that bind to SARS-CoV-1. The results showed that all 22 N-glycosylated sites of SARS-CoV-2 are modified by high-mannose type of N-glycans. MS/MS fragmentation clearly established the glycopeptide identities. Electron densities of glycans cover most of the Spike receptor binding domain of SARS-CoV-2, except YQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQ, similar to a region FSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQ in SARS-CoV-1. Other surface-exposed domains included those located on Central Helix, between amino acids 967 and 1016 of SARS-CoV-1, and 985 to 1034 of SARS-CoV-2 Spike protein. As the majority of antibody paratopes bind to peptide portion with or without sugar modification, we propose a snake-catcher model that a minimal length of peptide is first clamped by a paratope, and the binding is either strengthened by sugars close to peptide, or not interfered by sugar modification.

The combination of chemical cross-linking and mass spectrometry is currently a progressive technology for deriving structural information of proteins and protein complexes. In addition, chemical cross-linking is a powerful tool for stabilizing macromolecular complexes for single particle cryo-electron microscopy. Broad pallets of cross-linking chemistry, currently available for the majority of cross-linking experiments, still rely on the amine-reactive N-hydroxysuccinimide esters targeting mainly N-termini and lysine side chains. These cross-linkers are divided into two groups: water soluble and water insoluble; and research teams prefer one or another speculating on the benefits of their choice. However, the effect of cross-linker polarity on the outcome of cross-linking reaction has never been studied. Herein, we use both polar (bis(sulfosuccinimidyl) glutarate) and non-polar (disuccinimidyl glutarate) cross-linkers and systematically investigated the impact of cross-linker hydrophobicity on resulting distance constraints, using bovine serum albumin as a model protein.

The radiosensitivity of biological systems is strongly affected by the system oxygenation. On the nanoscopic scale and molecular level, this effect is considered to be strongly related to the indirect damage of radiation. Even though particle track radiolysis has been the object of several studies, still little is known about the nanoscopic impact of target oxygenation on the radical yields. We present here an extension of the chemical module of the Monte Carlo particle track structure code TRAX, taking into account the presence of dissolved molecular oxygen in the target material. The impact of the target oxygenation level on the chemical track evolution and the yields of all the relevant chemical species is studied in water under different irradiation conditions: different linear energy transfer (LET) values, different oxygenation levels, and different particle types. Especially for low LET radiation, a large production of two highly toxic species (HO₂^• and O₂^•− ), which are not produced in anoxic conditions, is predicted and quantified in oxygenated solutions. The remarkable correlation between the HO₂^• and O₂^•− production yield and the oxygen enhancement ratio observed in biological systems suggests a direct or indirect involvement of HO₂^• and O₂^•− in the oxygen sensitization effect. The results are in agreement with available experimental data and previous computational approaches. An analysis of the oxygen depletion rate in different radiation conditions is also reported.

The nondestructive testing of reinforced concrete chimneys, especially the high ones, is an important element of the assessment of their condition, making it possible to forecast their safe service lifespan. Industrial chimneys are often exposed to the strong action of acidic substances – they are adversely affected by the flue gas condensate on the inside and by acid precipitation on the outside. Initially, this results in the corrosion of the shell concrete and then in the corrosion of the reinforcing steel. During the service life of such chimneys their condition should monitored in order to prevent structural failures and indicate the most endangered parts of the structure. Owing to thermographic surveys one can monitor the hazards leading to the degradation of the chimney structure, which is particularly vital when due to the character of the production process the chimney cannot be put out of operation. The methods for the interpretation of results from thermovision studies to determine the safety and durability of industrial chimneys are shown.

Types of DNA recombination include homologous recombination and nonhomologous recombination. Homologous DNA recombination is a general term that includes exchange of information between chromatids: (reciprocal) crossing-over, gene conversion, and post-meiotic segregation. Gene conversion is now thought to be a type of non-Mendelian segregation of heterozygous markers near the recombination initiation site. Thus, it includes both gene conversion and post-meiotic segregation previously described. DNA non-HR including transpositional recombination and site-specific recombination. Our understanding of the molecular mechanism by which DNA recombination occurs has significantly increased in the past decades. Currently The synthesis-dependent strand annealing model is now thought to give rise to most or all noncrossovers, with the double-strand-break repair model forming mainly crossovers. The Shapiro model proposed by Dr. J. Shapiro explains the molecular mechanism of transpositional recombination. Site-specific recombination results from another distinct model. We previously proposed a novel theory which can provide a more reasonable and simpler explanation accounting for DNA HR including the 3 classes of recombinogenic events described above. In the new supplementedly molecular model, DNA meiotic recombination can be initiated by a copy choice mechanism, that is, copying part of 1 single-stranded DNA template, followed by DNA polymerase switching to another single-stranded DNA template, and then resuming the following DNA synthesis along the new template. The current review suggests that transpositional recombination and site-specific recombination should be initiated by copy choice during DNA synthesis rather than break/join mechanism. The work indicates that review of DNA nonhomologous recombination are very necessary. The novel theory would challenge earlier models accounting for transpositional recombination and site-specific recombination and would be critical to the understanding of the mechanisms. We hope copy choice initiating DNA nonhomologous recombination will be one of the concepts that are explored. Proper and specific experiments are required to reconstruct the detailed mechanism described here.

Coatings of reliable materials of thickness in few atoms to several microns on a viable substrate is the basic need of society which attend regular attention of scientific community working in various fields. Decorative and protective coatings, transparent and insulating coatings, coatings of medical implants and surgical instruments, coatings for drug delivery and security purposes, ultra-precision machine coatings and coatings of other miscellaneous uses are in routine demand for research and commercial purposes. Different hard coatings develop with significant composition of different nature atoms where their force-energy behaviors when recovering certain transition states provide provision for electron of outer ring belonging to gas atom to react for another clamp of energy knot clamping unfilled state of outer ring belonging to solid atom. Set suitable process conditions regulate switching force-energy behaviors of different nature atoms, which are nearly opposite to the ones originally existing in them. Thus, different nature transition state atoms locate points of developing hard coating between their original ground points as the gaseous nature atoms increase their potential energy as per increasing the gravitational force exerting at electron level while the solid atoms decrease their potential energy as per decreasing the gravitational force exerting at electron level. Ti-atom to Ti-atom binding is taken place under the difference of expansion level of lattice in the just land atom and landed atom where the position of nitrogen atoms becomes nearly at their interstitial site. Thus, different nature transition state atoms accommodate to be deposited at substrate surface positioned in the deposition chamber under suitable set parameters. In random arc-based vapor deposition system, depositing different nature atoms at substrate surface depends on the supplied energy where non-conserved forces are remained engage to keep adherence. On undertaking electron (of gas atom), another clamp of energy knot (of solid atom) is being endorsed by the mutually adjusting expansion-contraction of lattices belonging to two different nature atoms developing structure in the form of hard coating, which is known since antiquity. Different properties and characteristics of hard coatings emerged as per engaged forces under the set conditions of involved energy. The present study sets new trends not only in the field of films and coatings but also in the diversified class of materials, wherever, atoms recall their roles.

A new model of cosmology is proposed, where the state of high energy density commonly associated with the big bang is generated by the collapse of an antineutrino star that has exceeded its Chandrasekhar limit. To allow the first neutrino stars and antineutrino stars to form naturally from an initial quantum vacuum state, matter and antimatter are assumed to gravitationally repel. In this scenario, a degenerate antineutrino star in effective hydrostatic equilibrium has a density that is similar to the dark energy density of the ΛCDM model. When viewed from the core, such a star could today accelerate matter radially and emit the isothermal cosmic microwave background radiation, which addresses the horizon and flatness problems. This model and the ΛCDM model are in similar quantitative agreement with supernova distance measurements. The presented model is also in qualitative agreement with observed large-scale anisotropy and inhomogeneity, which distinguishes it from the ΛCDM model.

Shear connectors are used in steel beam–concrete slabs of composite frame and bridge structures to transfer shear force according to design loads. The existing Y-type perfobond rib shear connectors are designed for girder slabs of composite bridges. Therefore, the rib and transverse rebars of the conventional Y-type perfobond rib shear connectors are extremely large for the composite frames of building structures. We performed push-out tests of stubby Y-type perfobond rib shear connectors for composite frames. These shear connectors have relatively small ribs than conventional Y-type perfobond rib shear connectors. To confirm the shear resistance of these stubby shear connectors, we performed an experiment by using transverse rebars D13 and D16. The results indicate that these shear connectors have suitable shear strength and ductility for application in composite frame structures. The shear strengths obtained using D13 and D16 were not significantly different. However, the ductility of the shear connectors with D16 was 45.1% higher than that of the shear connectors with D13.

Piezoelectric properties are of significant importance to medical ultrasound, actuators, sensor, and countless other device applications. The mechanism of piezoelectric properties can be deeply understood from structure evolutions. In this paper, we report a diagram of structure evolutions of the Pb(Zn1/3Nb2/3)0.91Ti0.09O3 (PZN-9PT) single crystal with excellent piezoelectric properties among the orthorhombic, tetragonal, and cubic phases with temperature increasing from room temperature to 220 C. Through fitting the temperature dependence XRD curves with Gauss and Lorenz functions, we obtained the evolutions of the content ratio of three kinds of phases (orthorhombic, tetragonal and cubic) and the lattice parameters of the PZN-9PT system with the changes of temperature. The XRD fitting results together with Raman and dielectric spectrums show that the phase transitions of PZN-9PT are a typical continuous evolution process, very similar to the phase transition of paraffin from solid to liquid. Additionally, resonance and anti-resonance spectrum show excellent piezoelectric properties of the crystals, which probably originate from the nano twin domains, as demonstrated by the TEM images. Of particular attention is that the thickness electromechanical coupling factor kt is up to 72%.

We developed a sensor optimized for joint motion monitoring by exploring the effects of stitch pattern, yarn thickness, and NP number on the performance of knitted strain sensors. We conducted stretching experiments with basic weft-knit patterns to select the optimal stitch pattern and analyze its sensitivity and reproducibility. The plain stitch with a conductive yarn located on the reverse side exhibited the highest gauge factor value (143.68) and achieved excellent performance, with a stable change in resistance even after repeated sensing. For in-depth analysis, we developed six sensors using the aforementioned pattern with different combinations of yarn thickness (1-ply, 2-ply) and NP number (12, 13, 14). Based on bending experiments, the GF across all sensors was 60.2–1092, indicating noticeable differences in sensitivity. However, no significant differences were observed in reproducibility, reliability, and responsiveness, confirming that all the sensors are capable of joint motion monitoring. Therefore, the plain-patterned plating stitch structure with conductive yarn on the reverse side is optimal for joint motion monitoring, and the yarn thickness and NP numbers can be adjusted to suit different purposes. This study provides basic data for developing knitted strain sensors and offers insights into how knitting methods impact sensor performance.

This study presents a comprehensive investigation on an innovative mechanical system inspired by recent advancements in metamaterials, more specifically the work is focused on Origami-type structures for their intriguing mechanical properties. Originating from the specific fields such as aerospace for their lightweight and foldable characteristics, Origami mechanical devices exhibit unique non-linear stiffness, in particular, when suitably designed, they show Quasi-Zero Stiffness (QZS) characteristics within a specific working range. The QZS property, aligned with the High Static Low Dynamic (HSLD) stiffness concept, suggests promising applications such as a low-frequency mechanical passive vibration isolator. The study explores the vibration isolation characteristics of Origami-type suspensions, with a particular emphasis on their potential application as low-frequency passive vibration isolators. The Kresling Origami Module (KOM) has been selected for its compactness and compatibility with 3D printers. A detailed analysis using 3D CAD, Finite Element Analysis, and experimental testing have been carried out. The investigation includes the analysis of the influence of geometric parameters on the non-linear Force-Displacement curve. Multibody simulations validate the low-frequency isolation properties within the QZS region, and disparities in dynamic properties beyond the QZS range. The study underscores the transformative potential of Origami-type metamaterials in enhancing low-frequency vibration isolation technology. It also highlights challenges related to material properties and loading mass variations, providing valuable insights for future developments in this promising field.

(1) Background: Adolescent girls have increasingly faced mental health challenges. We examined prevalence trends and associated risk factors for depression among adolescent girls. (2) Methods: Data for girls aged 12 to 17 years (N=4346) from the 2021 cross-sectional National Survey on Drug Use and Health were analyzed. Factors associated with depression were examined using multiple regression analysis. (3) Results: Rates of severe depression were significantly higher (p<.001) in older girls (adjusted odds ratio [AOR]: 1.63, 1.61, those who did not have authoritative parents (AOR: 3.40), and those with negative school experiences (AOR: 4.03). Black and Asian/Native Hawaiian or other Pacific Islanders were less likely to report severe depression than white girls. As previously reported, non-White girls were significantly less likely to receive treatment for depression (p<.05). Parents’ characteristics and school experiences had no effect on the likelihood of receiving mental health treatment. (4) Conclusion: Depression has become increasingly common among American adolescent girls, who are now three times as likely as adolescent boys to have had recent experiences with depression. Our results show that family structure, parenting style, and negative school experiences significantly contribute to the rate of depression and that treatment disparities exist with regard to race and ethnicity. The results of our research could be valuable for policymakers, healthcare professionals, and educators in developing specific preventative initiatives and support networks that effectively address these unique challenges.

This review paper focuses on the joint toxicity and interaction of carbon-based nanomaterials (CNMs) with co-existing pollutants in aquatic environments. It explores the potential harmful effects of chemical mixtures on living organisms, emphasizing the importance of scientific mod-eling to predict mixed toxic effects. The study involved a systematic literature review to gather information on the joint toxicity and interaction between CNMs and various co-contaminants in aquatic settings. A total of 53 publications were chosen and analyzed, categorizing the studies based on the tested CNMs, types of co-contaminants, and the used species. Common test models included fish and microalgae, with zebrafish being the most studied species. The review under-scores the necessity of conducting mixture toxicity testing to assess whether the combined effects of CNMs and co-existing pollutants are additive, synergistic, or antagonistic. The development of in silico models based on the solid foundation of research data represents the best opportunity for joint toxicity prediction, eliminating the need in a great quantity of experimental studies.