This study investigated the spatial variability of soil organic carbon (SOC), total nitrogen (TN), soil microbial biomass carbon (SMBC) and soil microbial biomass nitrogen (SMBN) in Hongqipao reservoir dominated by different vegetation types and the possible relationships with other soil properties. Top 0–50cm soil samples were collected in sites dominated by different vegetation types within the reservoir littoral zone. There was high spatial variability for SOC, TN, SMBC and SMBN in the Hongqipao reservoir. In addition, the SOC, TN, SMBC and SMBN contents decreased with increasing soil depth. This could be attributed by the fact that when plants detritus decompose, most of their organic matter is mineralized and a new soil layer which contains a greater amount of organic carbon is formed at the top. According to Pearson's correlation values and redundancy analysis (RDA) results, SOC was significantly and positively correlated with TN likely because the vegetation organic matter and liter could be the main nitrogen sources. Similarly, soil moisture content (MC) was significant positive correlated with SOC and TN. Conversely, BD was significant negative correlated with SOC and TN contents in the 0-50 cm soil profiles. However, no significant correlations were observed between SOC, TN, SMBC and SMBN contents and soil pH values. SMBN was significantly and positive correlated with C:N ratio and BD and negative related with MC. Multiple linear regression model revealed that all measures soil properties in this study could explain higher significant variability of the response variables (SOC, TN, SMBC and SMBN contents). This implies that all the measured soil variables within the different vegetation types in the reservoir played a crucial role in determining the contents of SOC, TN, SMBC and SMBN. This study further suggests that vegetation types play a major role in determining the spatial characteristics of SOC and TN. Any changes in the vegetation types in the reservoir may influence the distribution of SOC and TN. This may affect the global carbon budget and the atmospheric greenhouse gas concentration significantly.

This study presents a new kinetic scheme for the mass yield prediction of waste lignocellulosic biomasses treated by Hydrothermal Carbonization (HTC). The proposed reactions are based on the decomposition, solubilization, and polymerization of each main fraction of the biomass: cellulose, hemicellulose, and lignin. The ash content was assumed to be inert. The kinetic parameters have been obtained by non-linear adjustment using a data set with 220 experimental runs collected from the literature. The results indicate that the pre-exponential factors range was from 7.33 x10¹ to 1.412x10⁵ min^-1, and activation energies were between 33.75 y 225.3 kJ/mol. A good fit is achieved between the observed and predicted data with an R² of 0.81 and an RMSE of 7.7 %. The proposed scheme was validated with the experimental data obtained by the HTC of sawdust (Pinus radiata) and rapeseed (Brassica napus). The experiments were carried out at temperatures of 190, 220, and 250 ºC and reaction times of 0, 30, 60, 90, and 120 min. The predicted values showed an average error of 2.3 and 3.5 %, respectively. Therefore, the kinetic scheme is a useful tool in the conversion analysis of waste biomass treated by HTC.

Alkali-containing submicron particles were measured continuously during three months, including late winter and spring seasons in Gothenburg, Sweden. The overall aims were to characterize the ambient concentrations of combustion-related aerosol particles and to address the importance of local emissions and long-range transport for the atmospheric concentrations in the urban background environment. K and Na concentrations in the PM1 size range were measured by an alkali aerosol mass spectrometer (Alkali-AMS) and a cluster analysis was conducted. Local meteorological conditions and some other data sets were obtained, and back trajectory analyses and chemical transport model (CTM) simulations were included for the evaluation. The Alkali-AMS cluster analysis indicated three major clusters: 1) biomass burning origin, 2) mixture of other combustion sources, and 3) marine origin. Low temperatures and low wind speed conditions correlated with high concentrations of K-containing particles, mainly due to regional emissions from residential biomass combustion; transport of air masses from continental Europe also contribute to cluster 1. The CTM results indicate that open biomass burning in the eastern parts of Europe may have contributed substantially to high PM2.5 concentrations (and to cluster 1) during an episode in late March. According to the CTM results the mixed cluster (2) is likely to include particles emitted from different source types and no single geographical source region seems to dominate for this cluster. The back trajectory analysis and meteorological conditions indicated that the marine origin cluster was correlated with westerly winds and high wind speed; this cluster had high concentrations of Na-containing particles, as expected for sea salt particles.

The bio-oil was largely produced by thermal pyrolysis of Jatropha-derived biomass wastes (denoted as Jatropha bio-oil) using a Pilot Plant with a capacity of 20 kg h-1 at Thailand Institute of Scientific and Technological Research (TISTR), Thailand. Jatropha bio-oil is an unconventional type of bio-oil, which is mostly composed of fatty acids, fatty acid methyl esters, fatty acid amides and derivatives, and consequently it contained large amounts of heteroatoms (oxygen ~ 20 wt.%, nitrogen ~ 5 wt.%, sulfur ~ 1000 ppm.). The heteroatoms, nitrogen especially, are highly poisonous to the metal or sulfide catalysts for upgrading of Jatropha bio-oil. To overcome this technical problem, we reported a stepwise strategy for hydrotreating of 100 wt% Jatropha bio-oil over mesoporous sulfide catalysts of CoMo/γ-Al2O3 and NiMo/γ-Al2O3 to produce drop-in transport fuels, such as gasoline- and diesel-like fuels. This study is very different from our recent work on co-processing of Jatropha bio-oil (ca. 10 wt%) with petroleum distillates to produce a hydrotreated oil as a diesel-like fuel (Chen et al., Catalysts 2018, 8, 59; http://dx.doi.org/10.3390/catal8020059). Jatropha bio-oil was pre-treated through a slurry-type high pressure reactor under severe condition, resulting in a pre-treated Jatropha bio-oil with relatively low amounts of heteroatoms (oxygen < 20 wt.%, nitrogen < 2 wt.%, sulfur < 500 ppm.). The light and middle distillates of pre-hydrotreated Jatropha bio oil was then separated by distillation at temperature below 240 oC, and the temperature of 240-360 oC. Deep hydrotreating of light distillates over sulfide CoMo/γ-Al2O3 catalyst was performed on a batch-type high pressure reactor at 350 oC and 7 MPa of H2 gas for 5 h. The hydrotreated oil was a gasoline-like fuel, which contained 29.5 vol.% of n-paraffins, 14.4 vol.% of iso-paraffins, 4.5 vol.% of olefins, 21.4 vol. % of naphthene compounds and 29.6 wt.% of aromatic compounds, and little amounts of heteroatoms (nearly no oxygen and sulfur, and less than 50 ppm of nitrogen), corresponding to an octane number of 44, and it would be suitable for blending with petro-gasoline. The hydrotreating of middle distillates over sulfide NiMo/γ-Al2O3 catalyst using the same reaction condition produced a hydrotreating oil with diesel-like composition, low amounts of heteroatoms (no oxygen and less than 50 ppm of sulfur and nitrogen), and a cetane number of 60, which would be suitable for use in drop-in diesel fuel.

Due to the increasing importance of mangroves in climate change mitigation projects, more accurate and cost-effective aboveground biomass (AGB) monitoring methods are required. However, field measurement of AGB may be a challenge because of its remote location and the difficulty to walk in these areas. This study is based on the Livelihoods Fund’ Oceanium project of 10,000 hectare mangrove plantations monitoring. In a first step, the possibility of replacing traditional field measurements of sample plots in a young mangrove plantation by a semiautomatic processing of UAV-based photogrammetric point clouds was assessed. In a second step, Sentinel-1 radar and Sentinel-2 optical imagery were used as auxiliary information to estimate AGB and its variance for the entire study area under a model-assisted framework. AGB was measured using UAV imagery in a total of 95 sample plots. UAV plot data was used in combination with non-parametric Support Vector Regression (SVR) models for the estimation of the study area AGB using model-assisted estimators. Purely UAV-based AGB estimates and their associated standard error (SE) were compared with model-assisted estimates using (1) Sentinel-1, (2) Sentinel-2 and (3) a combination of Sentinel-1 and Sentinel-2 data as auxiliary information. The validation of the UAV-based individual tree height and crown diameter measurements showed a root mean square error (RMSE) of 0.21 m and 0.32 m respectively. Relative efficiency of the three model-assisted scenarios ranged between 1.61 and 2.15. Although all SVR models improved the efficiency of the monitoring over UAV-based estimates, the best results were achieved when a combination of Sentinel-1 and Sentinel-2 data was used. Results indicated that the methodology used in this research can provide accurate and cost-effective estimates of AGB in mangrove young plantations.

Biomass is a widely distributed and renewable source of carbon. The main objective of this work is to produce an activated carbon from coconut shells with suitable characteristics to separate CO2 from biogas. The textural characterization of the adsorbent has been determined. Pure component adsorption isotherms of CO2 and CH4 at 30, 50 and 70 °C have been measured. Moreover, the performance of the produced activated carbon, as potential adsorbent for CO2 capture from a CO2/CH4 gas mixture has been evaluated under dynamic conditions in a purpose-built fixed-bed setup.

It is required to manage sustainable Short-Rotation Coppices (SRCs) as an important role on carbon sink and bioenergy output, because most of SRCs were established in reclaimed land in South Korea. However, during the last three years, growth pattern of the SRCs was remarkably changed with soil condition. This study aimed to identify the sustainability of SRCs on carbon storage, biomass and fuel pellet production, monitoring the neighboring vegetation of SRCs by land-use exchange, physiological change of poplar on seasonal trend, and to evaluate whether poplar is suitable for making wood pellets. The calculated biomass yield per area of poplar grown was 103.07 Mg per total area (55.6 ha), and volumes of carbon dioxide absorption was estimated to be 330 Mg CO2. Wood pellet quality based on the criteria scored third grade, indicating that poplar is suitable for manufacturing fuel pellets. Moreover, monitoring of the flora distribution in SRCs revealed changes in species composition. As halophyte was increased during drought, soil organic matter, net growth and total chlorophyll of poplar were significantly decreased. These findings indicated that photosynthesis and growth pattern of SRCs may be negatively affected by microclimate and will provide valuable information for effective management of SRCs.

The necessity to investigate suitable alternatives to conventional fossil fuels has developed the interests in many renewable energy alternatives, especially biomass resources which are widely available and allow to reach both environmental and socio-economic improvements. Among the bioenergy solutions the anaerobic digestion technology makes it possible to produce biogas by reusing and valorising agricultural residues and by-products. In Southern Italy, to date, the development of biogas sector is still very limited, despite the importance of the agricultural sector, especially of citrus and olive cultivation. For this reason, in previous studies the availability of two by-products, i.e., citrus pulp and olive pomace, was analysed in order to choose the most suitable area for a sustainable development of new biogas plants according to the new Biogasdoneright concept. In this paper, after a resume of the multi-step methodology which allowed the computation of biogas production, it was demonstrated that 15.9 GWh-e electricity and 24.5 GWh-e heat per year could be generate by reusing only these two kind of by-products, and could satisfy approximate 17% of the total electricity demand of the agricultural sector (90.2 GWh-e/year) in Catania.

In this work, we examined the effect of tropospheric emissions on tropospheric ozone (O₃) by conducting three-dimensional (3D) chemistry transport model (CTM) simulations. For the control run, the CTM model simulates tropospheric O₃ levels with a complete set of anthropogenic, biomass burning, and vegetation emissions [8]. For the no-emission simulation, all anthropogenic, biomass burning, and vegetation emissions were turned off. Comparisons of results from these two simulations exhibit the emission impacts on the tropospheric O₃. In the no-emission simulation, distinctive low surface O₃ with concentrations less than 5 ppbv prevail over the Amazon basin, tropical South America, tropical South Africa, Southeast Asia. Transport of air from these land areas downwind contributes to the low O₃ over the remote marine boundary layer. In contrast, elevated O₃ levels over the extra-tropical remote marine boundary layer are less supported by the anthropogenic and biomass burning emissions but more sustained by the downward transport of O₃ from the stratosphere. These results demonstrate that the northern hemisphere continental areas (north of 30^◦N ), polar regions, and tropical continental regions are more sensitive to the tropospheric emissions. The northern hemisphere winter is mostly dominated by the stratospheric processes, while the tropospheric emissions dominate over the southern hemisphere tropical continental areas from tropics to 30^◦S latitudinal bands. The northern hemisphere continental regions are increasingly dominated by tropospheric emissions from spring, to reach maxima in summer, and started to reduce in autumn months.

This study investigated the effects of soil crust development on the underlying soil properties. The field sampling work was conducted in June 2016 in the Hobq Desert in Inner Mongolia, North China. Soil crust samples and 0–6, 6–12, 12–18, 18–24, 24–30 cm deep underlying soil samples were taken from five representative areas of different soil crust development stages. All samples were analyzed for physicochemical properties including water content, bulk density, aggregate content, organic matter content, enzyme activities, and microbial biomass carbon and nitrogen. The results showed that the thickness, water content, macroaggregate (>250 μm) content, organic matter content, microbial biomass and enzyme activities of the soil crusts gradually increased along the soil crust development gradient, while the bulk density of the soil crusts decreased. Meanwhile, the physicochemical and biological properties of the soils below the algal and moss crusts were significantly ameliorated when compared with the physical crust. Moreover, the amelioration effects were significant in the upper horizons (approx. 0–12 cm deep) and diminished quickly in the deeper soil layers.

Background: Existing human cell immortalization methods made the cells obtain oncogenesis phenotype and/or caused the cells gain and/or lose chromosomes. Immortalized normal human T cells lines provide critical in vitro models for basic research and therapeutic products development.Methods: We utilized a CRISPR/Cas9 system to replace a single copy of the exon 2 of the cell cycle inhibitor gene CDKN2A (encoding p16 and p14 proteins) with a single copy of human telomerase reverse transcriptase (hTERT) to immortalize human primary CD8⁺ T cells (hCD8⁺T-TERT). By using Cas9 protein and low donor DNA copies/cell, we successfully immortalized hCD8⁺T cells with a single copy of hTERT transgene, which also avoided uncontrolled insertion of Cas9 gene and guide RNA vector.Results: Human primary CD8+ cells were immortalized and expanded more than 2.6 × 10⁷ times. Characterization of the cells revealed that the immortalized CD8⁺ T-TERT cells retained most of the cell surface markers and normal karyotype. The CD8⁺ T-TERT cells also retained the dependence of IL-2 and CD3/CD28 activator for survival and expansion.Conclusion: we established a stable immortalized CD8⁺ T cell line that had a phenotype consistent with T cells and will be a useful research model.

My innovative entropy measure, Ismail entropy, namely, (IE) is an ultimate generalization to numerous generalized entropies within the literature. The fractal dimension of IE is identified in this paper. On another applicative note, this paper offers some potential applications of fractal dimension to smart cities. The paper ends with closing remarks combined with some challenging open problems and the next phase of research.

Xyleborus beetles, a diverse group of ambrosia beetles, present significant challenges to forestry and agriculture due to their damaging burrowing behavior and symbiotic relationships with fungi. This review synthesizes current knowledge on the biology, ecology, and management of Xyleborus. We explore the beetles' life cycle, reproductive strategies, habitat preferences, and feeding habits, emphasizing their ecological and economic impacts. Control and management strategies, including preventive measures, chemical and biological control, and integrated pest management (IPM), are critically evaluated. Recent advances in molecular genetics and behavioral studies offer insights into genetic diversity, population structure, and host selection mechanisms. Despite progress, managing Xyleborus effectively remains challenging. This review identifies future research needs and highlights innovative control methods, such as biopesticides and pheromone-based trapping systems.

Background. Azithromycin (AZM) is widely used in cystic fibrosis (CF) treatment following clinical trials demonstrating improved lung function and fewer pulmonary exacerbations. While the precise mechanisms remain elusive, immunomodulatory actions are thought to be involved. We previously reported impaired phagocytosis and defective anti-inflammatory M2 macrophage polarization in CF macrophages. This study systematically analyzed the effect of AZM on the functions of unpolarized and M1/M2 polarized macrophages in CF. Methods: Monocytes, isolated from the venous blood of patients with CF (pwCF) and healthy controls (HCs) were differentiated into monocyte-derived macrophages (MDMs) and infected with P. aeruginosa. P. aeruginosa uptake and killing by MDMs in the presence or absence of AZM was studied. M1 and M2 macrophage polarizations were induced and their functions and cytokine release were analyzed. Results: Following AZM treatment, both HC and CF MDMs exhibited a significant increase in P. aeruginosa uptake and killing, however, lysosomal acidification remained unchanged. AZM treatment led to higher activation of ERK1/2 in both HC and CF MDMs. Pharmacological inhibition of ERK1/2 using U0126 significantly reduced P. aeruginosa uptake in HC MDMs. M1 macrophage polarization remained unaffected, however, AZM treatment led to increased IL-6 and IL-10 release in both HC and CF M1 macrophages. AZM also significantly increased the phagocytic index for both pHrodo E. coli and S. aureus in CF M1 macrophages. In CF, AZM treatment promoted anti-inflammatory M2 macrophage polarization, with an increased percentage of CD209+ M2 macrophages, induction of the M2 gene CCL18, along with its secretion in the culture supernatant. However, AZM did not restore endocytosis in CF, another essential feature of M2 macrophages. Conclusions: This study highlights the cellular functions and molecular targets of AZM which may involve improved uptake of both gram-positive and gram-negative bacteria, restored anti-inflammatory macrophage polarization in CF. This may in turn shape the reduced lung inflammation observed in clinical trials. In addition, we confirmed the role of ERK1/2 activation for bacterial uptake.

The discharge of industrial effluents containing toxic heavy metals in water sources has serious consequences for human health and the environment, and biosorption appears to be an environmental-friendly and cost-effective alternative that can be used for wastewater treatment. The use of different types of agricultural waste as biosorbents for the removal of toxic heavy metals, although an alternative, is quite difficult to apply in practice because these wastes have many other uses. Based on these considerations, in this study, soybean biomass (SB), soybean waste biomass obtained from oil extraction (SBW) and biochar obtained from soybean waste pyrolysis (BC-SBW) were testes as biosorbents form the removal of Pb(II) and Cd(II) ions, in batch systems. Under optimal conditions (pH = 5.4, 4.0 g biosorbent/L, room temperature (25 ± 1 C), contact time = 180 min), the biosorption capacity increase in the order: SB < SBW < BC-SBW for both metal ions (Pb(II) ions (69.43 mg/g < 99.81 mg/g < 116.83 mg/g) and Cd(II) ions (25.63 mg/g < 36.12 mg/g < 49.10 mg/g)), indicating that BC-SBW has the highest efficiency in removing toxic heavy metals. In addition, experiments on wastewater samples have shown that, in addition to significant reducing the content of heavy metals, BC-SBW also significant improved other quality indicators (such as: pH, TSM, CCO-Cr, CBO5), compared to the other biosorbents (SB and SBW). Quantitative evaluation of the biosorptive performance of each biosorbent (SB, SBW and BC-SBW) shows that BC-SBW has a real chance of being used on an industrial scale for wastewater treatment. All these aspects allowed the development of a circular approach for the use of soybean biomass in the removal processes of toxic heavy metals. This approach minimizes the shortcomings of using biomass as a biosorbent and increase the chance of using these materials in industrial practice.

: The activated carbons (ACs) derived from okara powder waste with high surface areas were modified with ammonia aqueous solution impregnation in an autoclave to enhance their CO2 adsorption properties toward CO2. The impregnated ACs were characterized in which surface chemical composition and properties of the ACs were analyzed by SEM-EDX, FTIR. Activated carbons were functionalized with ammonia aqueous solution (25%) through a hydrothermal process within 24; 48, and 72 hours. The adsorption performance of CO2 onto carbon samples was experimentally evaluated through a TPD CO2 measurement. FTIR spectra confirm the N-containing in N-modified activated carbons and the presence of the –C = O stretch and N-H groups. CO2 uptakes of N-modified activated carbons are 0.24; 1.78; 2.24 and 1.26 mmol/g, which are relatively comparable with those of activated carbons studied in in the literature.

The activated carbons (ACs) derived from okara powder waste with high surface areas were modified with ammonia aqueous solution impregnation in an autoclave to enhance their CO2 adsorption properties toward CO2. The impregnated ACs were characterized in which surface chemical composition and properties of the ACs were analyzed by SEM-EDS, FTIR. Activated carbons were functionalized with ammonia aqueous solution (25%) through a hydrothermal process within 24; 48, and 72 hours. The adsorption performance of CO2 onto carbon samples was experimentally evaluated through a breakthrough adsorption experimental setup at room temperature. FTIR spectra confirm the N-containing in N-modified activated carbons and the presence of the –C = O stretch and N-H groups. CO2 uptakes of N-modified activated carbons are 0.24; 1.47; and 1.20 mmol/g, which are relatively comparable with those of activated carbons studied in in the literature.

Reed (Phragmites autralis) is a plant species with a seasonal reproductive cycle, it has a very high biomass in U Minh Thuong National Park. This characteristic that management of forest fire is dificult in Vietnam. To evaluate height, diameter, density, growth, biomass of fresh and dry, biochar on reed plants; it include plant, stem, leaves, flowers; analysis indicators of growth, biomass, biochar on reed. compare chemical indicators of peat and biochar in U Minh Thuong and Kien Luong of Mekong Delta. Relationship of peat chemical with growth and biomass. Study adsorption from reed biochar with pig urine and inorganic chemical of nitrogen and phosphorus. Study on types of peatland thickness, each one had 5 plots, investigated height (Ht), diameter of stem (D0.0); weigh part of plants, stems, leaves and flowers. the soil samples collected on investigated 20 plots, biochar is analyzed for its chemical composition, then the biochar is adsorbed with pig urine and phosphorus and nitrogen inorganic. The results evaluated fresh biomass on parts of reed plant, dry biomass and biochar on parts of them. Results height 3.39 – 4.74 m, diemeter 1.8 – 3.17 cm, biomass 0.04 – 0.1 m3 / m2, weight 15.46 – 20.54 kg / m2. The dry weight / plant 127.34 – 358.58 g, a dry plant trunk 79.55 – 217.78 g, a dry plant leaves 33.78 – 112.16 g, a dry plant flowers 4.4 – 19.64 g. A plant Biochar 26.16 – 73.57 g, a trunk biochar 14.41 – 39.44 g, a leaf biochar 8.16 – 22.59 g, a flower biochar 2.59 – 11.54 g, Peat analysis, indicators decrease P2O5, SO42-, NH4+ and increase are pH, humic acid, N%, K2O, Fe2+. Compare biochar indicators of U Minh Thuong and Kien Luong indicators higher are 9/11 as humic acid, OM%, Ash%, C%, N%, P%, K%, Ca%, Mg%. Indicators lower are as pH and SiO. Reed biochar can adsorption the pig urine as ammonium, nitrate, nitrogen, phosphorus and it also adsorption inorganic as nitrogen and phosphorus. This discovery it is possible to propose the use of data for environment treatment and application of biochar fertilizer for agriculture in region.

Efficient utilization of biomass requires conversion into forms that can be optimally applied in energy generation. Briquetting involves compaction of biomass into solid blocks that are more efficient than raw biomass and provides for ease of transport and handling. These are improved when the briquettes possess high shatter index and compressive strength. Due to difference in nature and composition, it is imperative to define optimum conditions for the production of quality and durable briquettes for individual biomass compacted into briquettes. This study studied the effects of process variables on the strength and durability of biomass briquettes produced using Abura sawdust. The lateral compressive strength and drop shatter index were investigated whilst varying the temperature (100-150 °C), pressure (9-15 MPa) and hold time (15-30 min). The compressive strength ranged between 2.06 and 5.15 MPa whilst the shatter index was between 50 and 600. The pressure was significant to the determination of the compressive strength (p &lt; 0.1) and the shatter index (p &lt; 0.05). Mechanical characteristics of the binderless Abura sawdust briquettes can be improved by optimizing the densification variables during the briquetting process when moderate pressures are used for compaction.

Accurate estimation of livestock carrying capacity (LCC) and implementing an appropriate actual stocking rate (ASR) is key to sustainable management of grazing adapted alpine grassland ecosystems. Reliable determination of aboveground biomass is fundamental to these determinations. Peak aboveground biomass (AGBP) captured from satellite data at the peak of the growing season (POS) is widely used as a proxy for annual aboveground biomass (AGBA) to estimate LCC of grasslands. Here we demonstrate limitations of this approach and highlight the ability of POS in the estimation of ASR. We develop and trail new approaches that incorporate remote sensing phenology timings of grassland response to grazing activity, considering relations between biomass growth and consumption dynamics, in efforts to support more accurate and reliable estimation of LCC and ASR. Results show that based on averaged values from large-scale studies of alpine grassland on the Qinghai-Tibet Plateau (QTP), differences between AGBP and AGBA underestimate LCC by about 31%. Findings from a smaller-scale study that incorporate phenology timings into estimation of annual aboveground biomass reveal that Haibei alpine meadows were overgrazed by 11.5% during the study period from 2000-2005. The methods proposed can be extended to map grassland grazing pressure by predicting LCC and tracking ASR, thereby improving sustainable resource use in alpine grasslands.

Yield calculation is an important link in modern precision agriculture, which is an effective means to improve breeding efficiency, and adjust planting and marketing plans. With the continuous progress of artificial intelligence and sensing technology, yield calculation schemes based on image processing technology have many advantages such as high accuracy, low cost, and non-destructive calculation, and have been favored by a large number of researchers. This article reviews the research progress of crop yield calculation based on remote sensing images and visible light images, describes the technical characteristics and applicable objects of different schemes, and focuses on detailed explanations of data acquisition, independent variable screening, algorithm selection and optimization. Common issues are also discussed and summarized. Finally, solutions are proposed for the main problems that have arisen so far, and future research directions are predicted, with the aim of achieving more progress and wider popularization of yield calculation solutions based on image technology.

In the end, this paper analyzed the economy from the investment in plant construction, raw material collection, product production and product sales. The resulting products include pyrolytic carbon, pyrolytic oil, pyrolysis gas. The results showed that when the treatment scale was 1 ton h−1, the pyrolysis plants with three loading modes will always be in a state of loss during the 20-year running time. When the processing scale was 9 ton h−1, the pyrolysis plant can be profitable in the first year. In the sensitivity analysis, the influence of three pyrolysis products on the total return on investment was explored. The results showed that the price change of pyrolysis oil has the greatest influence on the total return on investment (Total ROI) under the three loading methods, The price change of pyrolysis gas has minimal impact on the Total ROI. This study provides basic data and basis for the commercialization of coal-biomass co-pyrolysis technology and investment in plant construction.

Lifetime cancer risk characterization of ambient PM-bound carcinogenic metals and polycyclic aromatic hydrocarbons (PAHs) were examined in the cities of Los Angeles (USA), Thessaloniki (Greece) and Milan (Italy), which share similar Mediterranean climates but are different in their urban emission sources and governing air quality regulations. The samples in Milan and Thessaloniki were mostly dominated by biomass burning activities whereas the particles collected in Los Angeles were primary impacted by traffic emissions. We analyzed the ambient PM2.5 mass concentration of Cadmium (Cd), Hexavalent Chromium (Cr(VI)), Nickel (Ni), Lead (Pb), as well as 13 PAH compounds in the PM samples, collected during both cold and warm periods at each location. The Pb exhibited the highest annual-average concentration in all 3 cities, followed by Ni, As, Cr(VI), Cd and PAHs, respectively. The cancer risk assessment based on outdoor pollutants was performed based on three different scenarios, with each scenario corresponding to a different level of infiltration of outdoor pollutants into the indoor environment. Thessaloniki exhibited rather high risk value associated with lifetime inhalation of As, Cr(VI) and PAHs. The highest cancer risk values were calculated in Milan where the lifetime risk of exposure to As, Cr(VI) and PAHs exceeded the US EPA standard across all scenarios by a considerable margin. The risk associated with Cr(VI) in Milan, which was the most significant among the investigated elements, ranged from (6.08±0.36)×10-6 to (9.82±0.58) ×10-6. In contrast, the estimated risks associated with metal and PAHs in Los Angeles were mostly comparable to the guideline value, even when the infiltration factor was assumed to be at peak. This observation highlights the impact of local air quality measures in improving the air quality and lowering the cancer risks in Los Angeles compared to the other two cities.

Biomass-derived carbon dots (CDs) are gaining much interest in recent times as it is a sustainable option with abundant availability, low cost, and tunable luminescence. Herein, we report a simple green synthesis method to produce highly fluorescent CDs from Eucalyptus globulus leaves using the one-pot hydrothermal approach. The fabricated CDs exhibit strong blue fluorescence with an excitation and emission maxima of 340 nm and 442 nm respectively. The highest quantum yield (QY) obtained was 60.7%. Due to its promising optical properties and biocompatibility, CDs can be a potential candidate for biosensing applications. Moreover, we employed a life cycle assessment (LCA) cradle-to-gate approach to study the environmental impacts of the synthesis strategy used for the fabrication of CDs. The results point out that citric acid is a main hotspot in CDs synthesis, regarding environmental impacts in most categories. This justifies the introduction of biomass, which reduces the amount of citric acid, thus leading to a more sustainable synthesis strategy for fabricating CDs.

The generation of eucalypt sawdust has increased in Uruguay with the expansion of pulp and paper industrial sites. Currently, most of this readily available feedstock is either not used or applied for producing heat and power by combustion in biomass boilers. In this work, eucalypt sawdust was subjected to steam explosion as the first step for cellulosic ethanol production within the biorefinery concept. The effect of sawdust moisture content, pretreatment temperature and residence time were evaluated, along with the influence of water washing of steam-exploded solids on enzymatic hydrolysis and fermentation yields. After steam explosion, 60% xylans and 97% acetyl groups were recovered mainly as oligomers and acetic acid in the pretreatment liquor. Eucalypt sawdust moisture content affected the enzymatic hydrolysis performance and glucan conversion efficiency. Water washing after pretreatment improved hydrolysis efficiencies and ethanol production yields by 10% with respect to the unwashed pretreated solids at the same experimental condition. The best ethanol yields were obtained using PSSF (pre-saccharification and simultaneous saccharification and fermentation) after pretreatment at 205°C for 10 min, using sawdust with an 8% moisture content. In this case, 227 L ethanol and 40 kg total xylose (including xylo-oligomers) were obtained per ton of dry eucalypt sawdust.

Air pollution and the increasing production of greenhouse gases has prompted greater use of renewable energy sources; the EU has set the use of green energy at 32 percent by 2030. With this in mind, in the last 10 years the demand for pellets in Italy has more than doubled making Italy the second largest consumer in Europe. The quality of the pellets burned in stoves is crucial to indoor and outdoor pollution. Among other parameters, moisture and ash are used to classify pellets according to EN ISO 17225:2014. This work involved the analysis of the organic and inorganic fraction of both some finished products on the Italian market and some raw materials (e.g., wood chips) sampled according to the technical standard EN 14778:2011. The analytical results showed the presence of some substances potentially harmful to human health such as formaldehyde, acetone, toluene and styrene for the organic fraction and nickel, lead and vanadium for the inorganic fraction. The chemometric approach showed that it is the inorganic fraction which is most responsible for the diversification of the samples under study. The detection of some substances may be a warning bell about the impact of such materials both for the environment and for the human health.

Brewers’ spent grain (BSG) is an important waste produced in beer companies with a high po-tential to be transformed into commercial by-products. The present paper reports a forecasting technology study with the aid of bibliographic review and patent analysis tools aiming to in-vestigate the maturity of certain technologies, considering the use of BSG on a closed-loop bio-refinery and circular bioeconomy concept integrated into a brewery. To evaluate the possibili-ties of production of high-added value products in Brazil, it was presented an overview of BSG’s scientific, technological, and marketing products and applications. The comparison between numbers of articles versus patents shows that the solutions proposed by research articles are not being transformed into maturated viable technologies. The results suggest that there is a gap between the scientific research in the institutions and their applications in industry, which lead to the destination of the BSG for more economically attractive investments when compared to research in Brazil. Ultimately, from the carried-out analysis, it was possible to propose a brew-ing process connected to the biorefinery system, showing the possibility to the newly arising brewery industries.

Plant roots have significant effects on the soil erosion rates, since they can strongly change the soil detachment capacity (Dc). This study quantifies Dc at different flow rates in soils with Alnus subcordata species, compared to three other species (Brachythecium plumose, Gleditsia caspica and Sambucus ebulus species) in the Saravan forest park and develops regression equations for predicting Dc. Undisturbed samples collected from soils with the four tree species and subjected to five slopes (from 4.3 to 38.3%) and five water discharges (from 0.28 to 0.71 l m−1 s−1) using a hydraulic flume. The results showed that Dc was significantly lower in soils with Alnus subcordata species compared to Brachythecium plumose, Gleditsia caspica and Sambucus ebulus species, as the consequence of the changes in the root characteristics, so that Dc was negatively correlated with root weight density, root length and root biomass. The unit stream power had high accuracy for predicting Dc for all of the studied species. The lowest value of rill erodibility (Kr) was obtained in soils with Alnus subcordata species using regression relationship between the Dc and the shear stress of the soil. This experiment helped to show the importance of plant roots in reducing the soil detachment rates and provided a contribution in understanding the choice of appropriate species for soil conservation.

Citron watermelon (Citrullus lanatus var. citroides) is an extremely drought-tolerant cucurbit crop widely grown in sub-Saharan Africa in arid and semi-arid environments characterized by drought. The species is a C3 xerophyte used for multiple purposes, including intercropping with maize and has a deep taproot system. The deep taproot system plays a key role in the species’ adaptation to dry conditions. Understanding root system development of this crop could be useful in identifying traits for breeding water-use efficient and drought-tolerant varieties. This study compared root system architecture of citron watermelon accessions under water-stress conditions. Nine selected and drought-tolerant citron watermelon accessions were grown under non-stress (NS) and water stress (WS) conditions using the root rhizotron procedure in a glasshouse. The following root system architecture (RSA) traits were measured, namely: root system width (RSW), root system depth (RSD), convex hull area (CHA), total root length (TRL), root branch count (RBC), total root volume (TRV), leaf area (LA), leaf number (LN), first seminal root length (FSRL), seminal root angle (SRA), root dry mass (RDM), shoot dry mass (SDM), root–shoot mass ratio (RSM), root mass ratio (RMR), shoot mass ratio (SMR) and root tissue density (RTD). The data collected on RSA traits were subjected to the analysis of variance (ANOVA), correlation and principal component analyses. ANOVA revealed a significant (p &lt; 0.05) accession × water stress interaction effect for studied RSA traits. Under WS, RDM exhibited significant and positive correlations with RSM (r = 0.65), RMR (r = 0.66), RSD (r = 0.66), TRL (r = 0.60), RBC (r = 0.72), FSRL (r = 0.73) and LN (r = 0.70). Principal component analysis revealed high loading scores for the following RSA traits: RSW (0.89), RSD (0.97), TRL (0.99), TRV (0.90), TRL (0.99), RMR (0.96) and RDM (0.76). In conclusion, the study has shown that the identified RSA traits could be useful in crop improvement programmes for citron watermelon genotypes with enhanced drought adaptation for improved yield performance under drought-prone environments.

The main purpose of this study was to determine the size and direction of the seasonal dynamics of organic carbon (Сmicro) and nitrogen (Nmicro) biomass of microorganisms and microbial index (Cmicro : Corg) of natural and agrocenoses with their different uses. Field research methods involved taking of soil samples in 0-10-, 10-20- and 20-40 сm layers. Under laboratory conditions, the content of total soil carbon was determined by dry oxygen combustion on a Vario EL III analyzer (Elementar Analyzensysteme, Hanau, Germany). The carbon content of microbial biomass (Сmicro) was determined by chloroform fumigation extraction method (CFE). To freshly taken soil samples (2 hours) and soil samples after their 24-hour fumigation with chloroform vapors, 0.5 M K2SO4 was added to extract biomass lysis products of soil microorganisms. The content of organic carbon and nitrogen in the biomass of microorganisms in the obtained filtrates was determined on the Elementar Liqui TOC II, Analyzensysteme GmbH, Germany. The carbon content of microbial biomass was calculated from the difference between carbon in fumigated and control samples using a factor of 0,45 - for carbon and 0,54 – for nitrogen. The microbial index of soils was determined by the ratio between the carbon of microorganisms and the total organic carbon of the soil – Cmicro : Corg • 100 (%). Average values and confidence intervals were determined for each defined indicator. The Bonferoni method was used to correct the errors of multiple comparative samples of a one-way ANOVA analyze. K. Pearson’s linear correlation analysis was used to establish the relationships between the dynamics of carbon biomass of microorganisms and organic carbon of the soil during the growing season. Our research has shown the dynamics of Сmicro, Nmicro, Сmicro : Nmicro and Cmicro : Corg during the growing season. Analysis of the box plot showed the largest amplitude of Сmicro changes in the upper 0-10 cm layer of izogumusol. The smallest difference in the quartile range (IQR0,25-0,75) was for no-till and overhang (Ab) in the upper 0-10-, no-till (NT) and fallow (F) - in the layer 10-20- and plowing (CT) - in a layer of 20-40 cm. The content of organic carbon biomass of microorganisms in the upper layer of izogumusol at the beginning of the growing season had the highest values of Ab (577,79  1,64 mg/kg), NT (485,43  1,97 mg/kg) and CT (470,43  0,77 mg/kg), the smallest - for F (370,15  2,18 mg/kg). The content of Nmicro during this period decreased from Ab to Comb (combined tillage), NT, CT, Rot (rotary tillage), RT (reduced (ridge) tillage) and F, respectively. In the 20-40 cm layer, the highest values of Сmicro and Nmicro were observed in mid-July. The lowest values of Сmicro and Nmicro and the largest – Сmicro : Nmicro were found in late August for all variants and layers of the study. The dynamics of the microbial index resembled the trends of Сmicro and Nmicro. The largest share of Smicro in Sorghum during the growing season, on average was: - Ab (1,82  1,85 %) and NT (1,66  1,52 %) - in the layer 0-10-, - Ab (1,23  1,27 %) and NT (1,29  1,32 %) - in the layer 10-20- and - Ab (1,19  1,09 %) and F (1,11  1,077 %) - in a layer of 20-40 cm. Different use of izogumusol affected the amplitude of seasonal changes of Сmicro and Nmicro and did not affect on their direction. The maximum content of Сmicro and Nmicro was observed at the beginning of the growing season - in a layer of 0-10 cm and in mid-July - in a layer of 20-40 cm, the minimum - at the end of the summer period. During this period, the widest ratio of Сmicro : Nmicro was for F and CT - in the layer 0-20 cm and CT and Rot - in the layer 20-40 cm. The Pearson’s correlation coefficient between Сmicro and Corg increased from the upper 0-10- to the lower 20-40 cm layer of izogumusol. "Strong" and "high" negative correlations have been established between Сmicro and Corg, but no pattern has been found between the correlation coefficient and tillage technologies.

Chaparral shrublands are the dominant wildland vegetation type in southern California and the most extensive ecosystem in the state. Disturbance by wildfire and climate change have created a dynamic landscape in which biomass mapping is key in tracking the ability of chaparral shrub-lands to sequester carbon. Despite this importance, most national and regional scale estimates do not account for shrubland biomass. Employing plot data from several sources, we built a random forest model to predict above ground live biomass in southern California using remote sensing data (Landsat NDVI) and a suite of geophysical variables. By substituting the NDVI and precipi-tation predictors for any given year we were able to apply the model to each year from 2000-2019. Using a total of 980 field plots, our model had a k-fold cross validation R2 of 0.51 and a RMSE of 3.9. Validation by vegetation type ranged from R2 = 0.17 (RMSE=9.7) for Sierran mixed conifer to R2 = 0.91 (RMSE = 2.3) for sagebrush. Our estimates showed an improvement in accuracy over a two other biomass estimates that included shrublands, with an R2 = 0.82 (RMSE = 4.7) compared to R2 = 0.068 (RMSE = 6.7) for a global biomass estimate and R2 = 0.29 (RMSE = 5.9) for a regional biomass estimate. Given the importance of accurate biomass estimates for resource managers we calculated the mean year 2010 shrubland biomass for the four national forests which ranged from 3.5 kg/m2 (Los Padres) to 2.3 kg/m2 (Angeles and Cleveland). Finally, we compared our estimates to field-measured biomass from the literature summarized by shrubland vegetation type and age class. Our model provides a transparent and repeatable method to generate biomass measure-ments in any year, thereby providing data to track biomass recovery after management actions or disturbances such as fire.

Utilization of Bidirectional Reflectance Distribution Function (BRDF) model parameters obtained from the multi-angular remote sensing is one of the approaches for the retrieval of vegetation structural information. In this research, the potential of multi-angular vegetation indices, formulated by the combination of multi-spectral reflectance from different view angles, for the retrieval of forest above ground biomass was assessed. This research was implemented in the New England region with the availability of a high quality forest inventory database. The multi-angular vegetation indices were generated by the simulation of the Moderate Resolution Imaging Spectroradiometer (MODIS) BRDF/Albedo Model Parameters Product (MCD43A1 Version 6) based BRDF parameters. The effects of seasonal (spring, summer, autumn, and winter) composites of the multi-angular vegetation indices on above ground biomass, angular relationship of the spectral reflectance with above ground biomass, and the interrelationships between the multi-angular vegetation indices were analyzed. Among the existing multi-angular vegetation indices, only the Nadir BRDF-adjusted NDVI ( and Hot-spot incorporated NDVI ( showed significant relationship (more than 50%) with the above ground biomass. This research proposed two more sensitive vegetation structural indices, Fore-scattering Back-scattering NDVI and Vegetation Structure Index (VSI). The Fore-scattering Back-scattering NDVI showed higher sensitivity (R² = 0.62, RMSE = 52.46) towards the above ground biomass than existing multi-angular vegetation indices. Furthermore, the VSI performed in the most efficient way explaining 64% variation of the above ground biomass, suggesting that the right choice of the spectral channel and observation geometry should be considered for improving the estimates of the above ground biomass. In addition, the right choice of seasonal data (summer) was found to be important for estimating the forest biomass while other seasonal data were either insensitive or pointless. The promising results shown by the VSI suggest that it could be an appropriate candidate for monitoring vegetation structure from the multi-angular satellite remote sensing.

In the industrial production of olive oil, both solid wastes and those produced from their incineration are a serious environmental problem since only 20% w/w of the fruit becomes oil and the rest is waste, mainly orujo and alperujo. A key aspect to transform these wastes into an important source of energy such as pellets is to recognize the most appropriate time of the year for waste drying, with the objective of minimizing the environmental impact of the volatile compounds contained in the waste. In this work, the emissions produced during thermal-mechanical drying were studied along a period of six months of waste storage in which alperujo and orujo were stored in open containers under uncontrolled environmental conditions. The studied emissions were produced when both wastes were dried in a pilot rotary drying trommel at 450ºC to reduce their initial humidity of around 70-80% w/w to 10-15% w/w. Results indicated that when the storage time of the wastes in uncontrolled environments increases, the emission of odorant compounds during drying also increases as a consequence of the biological and chemical processes occurring in the containers during waste storage. The main odorant VOCs were quantified monthly for six months at the outlet of the drying trommel. It was determined that the drying of this type of waste can be carried out properly until the third month of storage. Afterwards, the concentration of most VOCs produced widely exceeded the odor thresholds of selected compounds.

Antioxidant activity is an essential feature required for oxygen-sensitive merchandise and goods, such as food and corresponding packaging as well as materials used in cosmetics and biomedicine. For example, vanillin, one of the most prominent antioxidants, is fabricated from lignin, the second most abundant natural polymer in the world. Antioxidant potential is primarily related to the termination of oxidation propagation reactions through hydrogen transfer. The application of technical lignin as a natural antioxidant has not yet been implemented in the industrial sector, mainly due to the complex heterogeneous structure and polydispersity of lignin. Thus, current research focuses on various isolation and purification strategies to improve the compatibility of lignin material with substrates and enhancing its stabilizing effect. This contribution presents antioxidant capacity studies of various lignins depending on purification degree of the raw material. In detail, the antioxidant potential of lignin-based compounds is studied using the DPPH (2,2-diphenyl-1-picrylhydrazyl) assay. The purification procedure was monitored by thin layer chromatography (TLC) and showed that double-fold selective extraction is the most efficient purification procedure (confirmed by UV-Vis, FTIR, HSQC and 31P NMR spectroscopy, SEC and XRD analysis). Results are discussed regarding the dependency of antioxidant activity on lignin structure and biomass source. Thus, lignins obtained from industrial black liquor are compared with beech wood samples. In addition, the influence of lignin isolation (kraft versus organosolv) is discussed. Values of the antioxidant activity (DPPH inhibition) of kraft lignin fractions were 62-68% while beech and spruce/pine-mixed lignins showed values between 26, 64 and 42%, respectively. TPC values of the different isolated kraft lignin fractions varied between 26-35%, while beech, spruce/pine lignins were 34, 30 and 34%, respectively. Storage decreased the TPC values and increased the DPPH inhibition.

Activated carbons can be produced from biomass in a thermal process either in a direct carbonization-activation process or by first carbonizing the biomass and later on activating the biochars into activated carbons. The properties of the ACs are dependent on the type of process used for production. In this study, the properties of activated carbons produced in a one-stage and a two-stage process are considered. Activated carbons were produced by physical activation of two types of starting materials, bio chars produced from spruce and birch chips in a commercial carbonization plant and from the corresponding raw chips. The activated carbons produced were characterized regarding specific surfaces, pore volumes and pore size distributions. The un-activated bio chars had some degree of surface area 190 and 140 m²g^-1 for spruce and birch and pore volumes of 0.067 and 0.092 cm³g^-1. According to the results obtained, two slightly different types of activated carbons are produced depending if a one-stage or a two-stage carbonization and activation process is used. The ACs produced in the one-stage process had higher specific surface areas compared to the ones produced in a two-stage process (761-940 m²g^-1 vs. 540-650 m²g^-1) . In addition, total pore volumes were higher in one-stage process but development of micropores is greater compared to two-stage process. There was no significant difference in total carbon content between one-stage and two-stage process.

Dyadic data which is also called co-occurrence data (COD) contains co-occurrences of objects. Searching for statistical models to represent dyadic data is necessary. Fortunately, finite mixture model is a solid statistical model to learn and make inference on dyadic data because mixture model is built smoothly and reliably by expectation maximization (EM) algorithm which is suitable to inherent spareness of dyadic data. This research summarizes mixture models for dyadic data. When each co-occurrence in dyadic data is associated with a value, there are many unaccomplished values because a lot of co-occurrences are inexistent. In this research, these unaccomplished values are estimated as mean (expectation) of random variable given partial probabilistic distributions inside dyadic mixture model.

As the rapid development of communication industry, especially the 5G communication and IOT, there will be plenty of electromagnetic (EM) waves in the free space, which carry lots of energies. However, some of these energies are wasted in free space. To reuse these wasted energies, significantly growing interests are towards to the energy harvesting antennas. This paper is aimed to investigate a wearable antenna which can transfer RF energy from ambient sources to direct current by a soft and portable textile antenna. Among the numerous signals in mobile network, the GSM 1800, 3G, WiFi and 4G/5G will be chosen due to the city signal intensity distribution. Hence, a corresponding triple bands antenna has been designed to cover those frequency bands. The CST STUDIO SUITE is used in whole process of antenna design and simulation. The proposed antenna is a hooked dipole antenna with tuning bar (HATB) whose ends have small folded part in each side for better bandwidth performance. The presented antenna provides a wide operating band from 1.8 GHz to 2.5 GHz below -10 dB in return loss. And methods to overcome interference between antennas is found. Furthermore, using the corresponding rectifier to achieve the RF/DC conversion. The overall efficiency of whole rectifier is about 56.8 %, and output power level of the antenna system is 45.92nW. The experimental results could indicate that my textile hooked antenna harvester is a good choice for the charging system of personal wearable attachment, which could achieve low power absorbing for long distance anytime and anywhere.

Natural Gas (NG) processing is a prominent industrial separation process. Among the available techniques, the innovative membrane process shows potential for efficient removal of impurities, including carbon dioxide (CO₂). This study focuses on utilizing breakthroughs in membrane separation to drive sustainable CO₂ extraction from natural gas. Through comprehensive research and analysis, we explore the effectiveness and feasibility of membrane-based systems in removing CO₂ impurities from NG, thus promoting greener and more sustainable industrial practices. Our findings underscore the transformative nature of membrane separation technology, presenting new possibilities for a more environmentally-friendly and sustainable approach to CO₂ extraction from natural gas.Natural Gas (NG) processing utilizes various techniques for impurity removal, with the membrane process emerging as a promising option for efficient carbon dioxide (CO₂) extraction. This research proposes the integration of a simple mathematical model into ASPEN HYSYS to design a membrane system for CO₂/CH₄ separation. The study also investigates parameter sensitivities by altering operating conditions, such as feed composition and pressure, as well as membrane properties, including selectivity. By analyzing these variables, we aim to optimize the performance and efficiency of the membrane system, facilitating the sustainable extraction of CO₂ from NG. The findings contribute to advancing the design and operation of membrane-based processes for CO₂ separation, paving the way for greener and more sustainable industrial practices. In addition, this study explores various configurations for optimizing the design of the membrane system, including single-stage with and without recycling as well as double-stage configurations. The investigation demonstrates that methane recovery can be enhanced through the recycling of the permeate stream and by implementing a double stage membrane system. These findings highlight the potential for improving the efficiency and performance of the membrane system, enabling higher methane recovery rates. By considering different configurations, this research contributes to the development of more effective and sustainable CO₂ extraction processes from natural gas.

Renewable energy is essential to environmental sustainability and ranks high among the United Nations strategic goals. In this context, as opposed to conventional biomass gasification, co-gasification emerges as a promising technological pathway to effectively combine the distinct benefits of various gasification feedstocks in order to generate hydrogen-rich syngas. The goal of achieving net-zero emissions has further raised the demand for biomass co-gasification. However, the complicated reactions involved in co-gasification process pose challenge in optimizing the process parameters for increased productivity and performance. To the author’s knowledge, there is no consensus regarding the most suitable machine learning (ML) based regression models for optimizing biomass-plastics co-gasification process, as no prior research has examined the effectiveness of different regression models for this process. Further, the practical application of ML models is adversely affected by their black box nature and lack of interpretability. To address these gaps, the objective of the currect research is two-fold: Firstly, to model the co-gasification process using seven different ML algorithms. Secondly, to develop an evaluation framework and assess model interpretability to select an ideal model for co-gasification interpretation and optimization. The support vector regression(SVR) model demonstrated the most reliable predictive performance. The study employed learning curve analysis and cross validation analysis to substantiate the model predictive performance and exhibit its potential to generalize. Beyond performance analysis, Shapely additive explanation, (SHAP) is first explored in the realm of cogasification to interpret the prediction of the studied models from global and local perspective. The research findings are expected to provide valuable insights to better understand and optimize biomass-plastics cogasification process for H2-rich syngas production.

It is difficult for ordinary rice to break the zinc-rich standard. However, employing multiple unique rice cultivar resources through biofortification of agronomic measures to achieve this target is a novel attempt that has rarely been reported. In this study, the effects of foliar application of water-soluble zinc-rich fertilizer (400 g/ha Zn) on seven different cultivars (GFHN 166, GFHN168, GFHN 169, GH 1, GXHZ, GHSZ and YXN) of colored rice at heading stage were investigated through pot experiment. The result indicated that foliar biofortification significantly increased the zinc content of colored rice grains by 43.89%, and the zinc accumulation in grains increased by 64.50%. In addition, the SPAD value and grain protein content also increased significantly by 2.15% and 2.86%, respectively. Among these, GXHZ and GHSZ could realize the zinc content of polished rice up to 69.7 mg/kg and 55.4mg/kg, breaking through the standard of zinc-enrich rice (45mg/kg). GXHZ plant height increased by 11.22%, and the zinc harvest index (6.44%) and zinc use efficiency (26.79%) were the highest. Meanwhile, the biofortification promoted the SPAD value of GHSZ and the protein content of GFHN 166 by 4.95% and 24.81%, respectively. And zinc-treated colored rice at the concentration used in this study has no risk to human health. Combining the foliar application of exogenous zinc with the utilization of specific cultivars resources could realize zinc-enrich rice production, and provide an additional resolution for tackling the hidden hunger problems.

The utilization of solar energy technology is crucial for generating hydrogen in sustainable energy systems. While traditional methods involving natural gas, coal, and oil have been employed for hydrogen production, this study aims to explore environmentally friendly techniques. Green hy-drogen, despite being a more expensive option compared to fossil fuel-derived hydrogen, has prompted engineers to develop affordable and low-carbon technologies. The microgrid model was developed to showcase a self-contained DC islanded system designed to supply power to an electrolyzer, capitalizing on both a solar array and an energy storage unit. This comprehensive model offers a versatile platform for evaluating the operational dynamics involved in the sustainable production of green hydrogen. Over a span of seven days, it permits the as-sessment of hydrogen generation characteristics through the utilization of solar energy, either di-rectly from a solar array or through an integrated system that incorporates energy storage. The model encompasses a multi-domain framework, encompassing electrical, thermal liquid, and thermal gas aspects, facilitating a holistic exploration of the intricate processes underlying the green hydrogen production system. Through this simulation, the feasibility and efficiency of harnessing renewable energy sources for hydrogen production in an off-grid setting can be comprehensively examined and optimized, contributing to the advancement of sustainable energy solutions.

Shrubland and forestland covers are highly prone to fire. The Normalized Difference Vegetation Index (NDVI) has been widely used for biomass quantitative assessment. This study aims were the following: (1) to compute the NDVI annual curve for two types of land cover eucalypts and shrubland areas; (2) to collect field data in these two types of land cover to estimate aboveground biomass (AGB); and (3) to produce AGB maps for eucalypts and shrubland areas by modelling AGB with NDVI and validate them with other data sources. A study area in the central inland Portugal was considered. The Sentinel-2 MSI imagery for the year of 2022 and 2023 were used to compute the NDVI. The NDVI annual curve for 2022 showed a minimum observed between July and August, in accordance with the climatological data, and allowed differentiating eucalypts from shrubland areas. Spectral signatures also confirmed this differentiation. The fitted linear models for AGB prediction using the NDVI imagery showed good fitting performances (R2 of 0.76 and 0.69). The AGB maps provide a relevant decision support tool for forest management and for fire hazard and fire severity mitigation. Further research is needed using more robust data sets for models’ independent validation.

Pygoscelis penguin populations in the Antarctic Peninsula have dropped dramatically in the last 50 years. The main probable cause is the reduction in Krill (Euphausia superba), the most important feeding item for Pygoscelis penguins during breeding. The scientific community has expressed concerns on the potential that competition with the fishery during periods of low krill availability might be exacerbating the effects of climate change. By bringing together data on breeding success of penguin colonies throughout the Antarctic Peninsula with information of krill availability from acoustic survey and krill fishery monitoring data, we were able to show that fishery has had in the past an effect over breeding success. That is a consequence of a management strategy based on a constant catch level enabling the fishery to maintain the same levels of production even when krill availability is low. The total catch limit may have represented a substantial amount of the available krill biomass in some years, and we detected that when the catch goes over 5% of the available biomass during summer, breeding success of penguins decreased by one third. We discuss the implications of our findings to the revised ecosystem-based management strategy of the krill fishery in Antarctica.

The building sector of most tropical countries still use predominantly primary biomass as the principal fuel. This has adverse effects like CO2 emission and deforestation and is associated with issues like poverty, ill-health, and low standard of living. Therefore, energy policies try to improve on the efficiency of firewood and charcoal end-use technologies, to palliate the negative effects. In this research, the global change assessment model (GCAM) is used, to investigate the impact of efficiency improvement on the energy consumption pattern of the building sector of developing countries. The aim of the study is to provide empirical data that would better inform policymakers on the effects of modernizing these primary fuels. The study developed three scenarios with different levels of efficiency improvements. The results show that efficiency improvement rather increases primary biomass consumption and CO2 emission. However, there is a fall in the consumption of traditional biomass in the second half of the modelling period. The increase in biomass-based fuels consumption was seen to be linked to their affordability. Therefore, policymakers need not only elaborate policies that improve biomass efficiency, but also introduce and motivate other clean cooking fuels like butane, biogas, and electricity.

As a renewable industrial crop, Miscanthus offers numerous advantages, namely high photosynthesis activity (as a C4 plant) and exceptional CO2 fixation rate. These properties make Miscanthus very attractive for industrial exploitation, such as lignin generation. Here, we present a systematic study analyzing the correlation of the lignin structure with Miscanthus genotype and plant portion (stem versus leaf). Specifically, the ratio of the three monolignols and corresponding building blocks as well as the linkages formed between the units have been studied. Depending on the Miscanthus genotype and plant component (leaf versus stem), correlations between chemical structure and properties of the lignins have been determined, i.e. correlations in molecular weight, polydispersity and decomposition temperature. Lignin isolation was performed using non-catalyzed organosolv pulping and the structure analysis includes NREL, FTIR, UV-Vis, HSQC-NMR, TGA, pyrolysis GC/MS. Structural differences were found for stem and leaf-derived lignins. Compared to beech wood lignins, Miscanthus lignins possess lower molecular weight and narrow polydispersities (< 1.5 Miscanthus vs. > 2.5 beech) corresponding to improved homogeneity. In addition to conventional univariate analysis of FTIR spectra, multivariate chemometrics revealed distinct differences for aromatic in-plane deformations of stem versus leaf-derived lignins. These results emphasize the potential of Miscanthus as low-input resource and Miscanthus-derived lignin as promising agricultural feedstock.

Maritime Continent (MC) positions in between Asian and Australian summer monsoons zone. Its complex topography and shallow seas around it is a major challenge for the climate researchers to model and understand it. Monsoon in this area is affected by inter-scale ocean-atmospheric interactions like El-Niño Southern Oscillation (ENSO), Indian Ocean Dipole (IOD) and Madden-Julian Oscillation. Monsoon rainfall in MC (especially in Indonesia and Malaysia) profoundly exhibits its variability dependency on ocean-atmospheric phenomena in this region. This monsoon shift often introduces to dreadful events like biomass burning (BB) in Southeast Asia (SEA) which sometimes leads to severe trans-boundary haze pollution. In this study, the episode of BB in 2015 of SEA is highlighted and discussed. Observational satellite datasets are tested by performing simulations with numerical weather prediction (NWP) model using WRF-ARW (Advanced research WRF). Observed and model datasets are compared to study the sea surface temperature (SST) and precipitation (rainfall) anomalies influenced by ENSO, IOD and MJO. Correlations have been recognised which explains the delayed rainfall of regular monsoon in MC due to the influence of ENSO, IOD and MJO during 2015 BB episode, eventually leading to intensification of fire and severe haze.

The production of recombinant proteins in Escherichia coli is often challenged by cytoplasmic expression due to proteolytic degradation and inclusion body formation. Extracellular expression can overcome these problems by simplifying downstream processing and improving protein yields. This study aims to compare the efficiency of two Bacillus subtilis chitosanase signal peptides in mediating extracellular secretion in E. coli. We identified a naturally occurring mutant signal peptide (mCsn2-SP) from B. subtilis CH2 chitosanase (CH2CSN), which is characterized by a deletion of six amino acids in the N-region relative to the signal peptide (Csn1-SP) from B. subtilis CH1 chitosanase (CH1CSN). The CH1CSN and CH2CSN genes were cloned into the pET-11a vector and protein secretion was evaluated in E. coli BL21(DE3) host cells. Expression was induced with 0.1 mM and 1 mM isopropyl β-D-1-thiogalactopyranoside (IPTG) at 30°C for one and three days. CH2CSN showed higher secretion levels compared to CH1CSN under all experimental conditions, especially with 0.1 mM IPTG induction for 3 days, which resulted in a 2.37-fold increase in secretion. Furthermore, it was demonstrated that mCsn2-SP is capable of secreting human Cu,Zn-superoxide dismutase (hSOD) in E. coli BL21(DE3) and successfully translocating it to the periplasmic region. This study represents the inaugural investigation into the utilisation of a naturally modified signal peptide, thereby corroborating the assertion that signal peptide deletion variants can influence protein secretion efficiency. Furthermore, the findings substantiate the proposition that such variants can serve as a viable alternative for the secretion of heterologous proteins in E. coli.

Very disparate types of cell populations exhibit similar transcription specificity for certain genes. We identified 20 genes that were expressed preferentially in myoblasts and cerebellum (Myob/Cbl genes) and examined their cell/tissue-specific epigenetics using a combined approach of comparing DNA methylation, chromatin accessibility, and RNA expression in many different cell populations. Some Myob/Cbl genes shared DNA hypo- or hypermethylated regions in myoblasts and cerebellum. Particularly striking was ZNF556, whose promoter is hypomethylated in expressing cells but highly methylated in the many cell populations that do not express the gene. In reporter gene assays, we demonstrated that its promoter’s activity is methylation-sensitive. The atypical epigenetics of ZNF556 may have originated from its promoter’s hypomethylation and selective activation in sperm progenitors and oocytes. Five of the Myob/Cbl genes (KCNJ12, ST8SIA5, ZIC1, VAX2, and EN2) have much higher RNA levels in cerebellum than in myoblasts and displayed myoblast-specific hypermethylation upstream and/or downstream of their promoters that may downmodulate expression. Differential DNA methylation was associated with alternative promoter usage for Myob/Cbl genes MCF2L, DOK7, CNPY1, and ANK1. Myob/Cbl genes PAX3, LBX1, ZNF556, ZIC1, EN2, and VAX2 encode sequence-specific transcription factors, which likely help drive the myoblast and cerebellum specificity of other Myob/Cbl genes. Our study extends our understanding of epigenetic/transcription associations related to differentiation and may help elucidate relationships between epigenetic signatures and muscular dystrophies or cerebellar-linked neuropathologies.

The presence of potentially pathogenic bacteria on veterinary clinic surfaces may be problematic. In this study we collected swab samples (Fisherbrand, double transport swabs with Stuart’s liquid medium) and water samples from five veterinary rehabilitation clinics. Swabs and water samples were transported to a microbiology lab for processing. At the lab swabs were used to inoculated Hardy’s Cdiff Banana broth (for Clostridium difficile [Cdiff]), and five different types of bacterial growth media, including: Hardy CHROM MRSA agar (methicillin resistant Staphylococcus aureus [MRSA], and S. pseudintermedius [SIM]), Mannitol Salt Agar (S. aureus), Eosin Methylene Blue agar (enterics [ENT]), Pseudomonas Isolation agar (Pseudomonas sp.), and Tryptic Soy Agar [TSA] (non-specific). The most prominent species cultured was Cdiff (on nearly 55% of swabs). Bacillus sp. and Enterics were encountered on nearly 35% of swabs, with MRSA and SIM on just over 10% of swabs. The most contaminated sample site was harnesses/life jackets used with the underwater treadmill (33% of swabs). Underwater treadmill water had total bacterial counts from 1.6 to 2.7 e3 cfu/ml. Of all bacterial species detected SIM tends to be more pathogenic for dogs. Targeted cleaning/disinfecting in these clinics could help reduce risks for both animals and caregivers utilizing these clinics.

To mitigate the emissions of greenhouse gases from fossil fuels, biodiesel production has be-come more attention over the past decade, especially for the use of waste cooking oils and non-edible oils as starting feedstock. For the biodiesel production process, the suitability of a catalyst is a core function implemented in the transesterification reaction. heterogeneous cata-lysts were superior to homogeneous catalysts due to some advantages such as no saponification products formed, recyclability, and less equipment corrosion. Recent studies also revealed that heterogeneous solid base catalysts are widely used for the production of biodiesel. Further-more, the biomass-based ash derived from herbaceous & agricultural biomass is increasing rap-idly because of its environmental sustainability, high biodiesel yield and low catalyst cost. To search for the depth of green catalysts, this mini-review paper thus focused on the summary of various heterogeneous biomass-based potassium-rich catalysts for the sustainable production of biodiesel. Due to cocoa pod husk that’s rich in potassium-containing minerals, it was found that its derived ash may be the most commonly used solid base catalyst in the biodiesel production.

Improving photobioreactor performance for microalgae cultivation has attracted many researchers over the past years. One of the primary challenges associated with existing photobioreactors is the light penetration. An effective photobioreactor design should maximize light penetration, ensuring uniform illumination throughout the reactor. This study aims to assess the impact of light intensity on microalgal growth from the perspective of energy efficiency and productivity in two photobioreactors. A novel cactus-like and a cylindrical photobioreactor were designed and fabricated using 3D printing technology. These two photobioreactors were used to cultivate two strains of microalgae. The novel photobioreactor achieved a maximum biomass productivity of 0.99 g/L/d and a maximum energy efficiency of 0.3139 g/d/kWh. The cylindrical photobioreactor reached a maximum biomass productivity of 0.74 g/L/d and 0.2199 g/d/kWh of energy efficiency. The increase in biomass productivity can be linked to enhancements in the photobioreactor's surface-to-volume ratio and better light utilization.

Nanoparticles (NP), Nanoaerosols (NA), ultrafine particles (UFP), and PM0.1 (particles with a diameter ≤ 0.1 µm or 100 nm) are interchangeably used in the field of atmospheric studies. PM0.1 are emitted from both natural and anthropogenic sources. The main emission sources of PM0.1 are combustion processes, including biomass and fossil fuel. Moreover, secondary formation via atmospheric photochemical reactions can also occur depending on meteorological conditions and the suspended pollutant species. Identifying the physical and chemical characteristics and spatial and temporal variations is vital in terms of understanding the effect of NPs on the environment, the global climate, and human health risks. This review article summarizes recent research on PM0.1 in Thailand. The review involves peer-reviewed papers from Scopus and the Web of Science databases, and includes the most recently published articles in the past ten years (2013-2022). UFPs mainly come from the combustion processes such as motor vehicles. The high mass concentration of PM0.1 that occurs during the dry season in which open fires depend on the specific region of Thailand. Particulate pollution from local and cross-border countries also needs to be considered in terms of the concentrations of ambient nanoparticles. The overall conclusions reached will likely have a beneficial long-term impact on achieving a blue sky over Thailand through the development of coherent policies and managing new air pollution challenges and sharing knowledge with a broader audience.

2,5-Di(hydroxymethyl)furan (DHMF) is a high-value chemical block than can be synthesized from 5-hydroxymethylfurfural (HMF), a platform chemical that results from the dehydration of biomass-derived carbohydrates. In this work, the HMF biotransformation capability of different Fusarium species was evaluated and F. striatum was selected to produce DHMF. The effects of the inoculum size, glucose concentration and pH of the media over DHMF production were evalu-ated by a 23 factorial design. A substrate feeding approach was found suitable to overcome the toxicity effect of HMF towards the cells when added at high concentrations (>75 mM). The pro-cess was successfully scaled-up at bioreactor scale (1.3 L) with excellent DHMF production yields (95%) and selectivities (98%). DHMF was purified from the reaction media with high recovery and purity by organic solvent extraction with ethyl acetate.

This literature review aims to gain a deeper understanding of Spinosaurus aegyptiacus’s dorsal sail regarding its function as thermoregulation, display, or hydrodynamic. The function of S. aegyptiacus’s dorsal sail has been widely debated for many years. The three most popular hypotheses are that it was used as a biological mechanism of thermoregulation, display, or hydrodynamic. The display hypothesis includes attracting mates, intimidating rivals, and social communication with other members. This literature review delves into each of the three hypotheses using past studies and excavation sites to analyze their validity. For the hydrodynamic aspect, the lifestyle of S. aegyptiacus must first be established. Based on existing research, we cannot conclude that there is a definitive primary function of Spinosaurus aegyptiacus’s dorsal sail. However, it is likely that its sail served the crucial function of display, since it would have a large surface area and could thus be a distinguishable characteristic of S. aegyptiacus that could determine mating success. Additionally, it is probable that the sail had supplementary roles in thermoregulation and hydrodynamics.

Escherichia coli is an indicator microorganism in One Health antibiotic resistance surveillance programmes. The purpose of the study was to describe and compare E. coli isolates obtained from pigs and human contacts from a commercial farm in South Africa using conventional methods and whole genome sequencing (WGS). Porcine E. coli isolates were proportionally more resistant phenotypically and harboured a richer diversity of antibiotic resistance genes, as compared to human E. coli isolates. Different pathovars, namely ExPEC (12.43%, 21/169), ETEC (4.14%; 7/169), EPEC (2.96%, 5/169), EAEC (2.96%, 5/169) and STEC (1.18%, 2/169) were detected at low frequencies. Sequence type complex (STc) 10 were the most prevalent (85.51%, 59/169) among human and porcine isolates. Six STcs (STc10, STc86, STc168, STc206, STc278 and STc469) were shared at the human-livestock interface according to multilocus sequence typing (MLST). Core genome MLST and hierarchical clustering (HC) showed that human and porcine isolates were overall genetically diverse, but some clustering at HC2 to HC200 were observed. In conclusion, even though the isolates shared a spatio-temporal relationship, there were still differences in the virulence potential, antibiotic resistance profiles, and cgMLST and HC according to the source of isolation.

The identification of a new virus Kiparis-144 (KiparisV) in a half-fed tick I persulcatus, removed from a person in the south of the Russian Far East, determined the goal of further research - to study its role in human pathology and the characteristics of its behavior in the tick microbiome. An ELISA study of 439 blood samples from people affected by tick bites indicated a fairly frequent (up to 16.4±1.7%) encounter of people with the KiparisV virus in the territory of natural foci of the Primorsky Territory. It has been shown that this virus, when mono-infected, can cause clinical symptoms characteristic of acute respiratory diseases. During co-infection under the influence of the KiparisV, there was an increase in the activity of Borrelia spp. with the constant production of antibodies to them only of the IgM class and clinical symptoms of Lyme disease for one year (observation period). Electron microscopy of the KiparisV found in a tick removed from a patient showed a picture of the relationship of the KiparisV (up to 100 nm in size) with unknown representatives of the tick microbiome - pathogens of a viral or bacterial nature. In a comparative aspect, a similar electron microscopic picture of the interaction of the KiparisV virus with a known pathogen of viral nature, the ectromelia virus (ECTV), is presented. The importance of the electron microscopy method in describing the tick microbiome is shown. Thus, it has been established that when co-cultivated in the system the helper-virus KiparisV probably tends to use another pathogen of the tick microbiome for its reproduction, influencing its pathogenicity.

a Special Issue of Microorganisms devoted to ‘Microbial Biocatalysis and Biodegradation’ would be incomplete without some form of acknowledgement of the many important roles that dioxygen-dependent enzymes (principally mono- and dioxygenases) play in relevant aspects of biooxygenation. This is reflected by the multiple strategic roles that dioxygen -dependent microbial enzymes play both in generating valuable synthons for chemoenzymatic synthesis, and in facilitating key reactions that drive the global geochemical Carbon Cycle. A useful insight into this relationship can be gained by reviewing the evolution of the current status of 2,5-diketocamphane 1,2-monooxygenase (EC 1.14.14.108) from camphor-grown Pseudomonas putida ATCC 17453. Over the last sixty years, the perceived nature of this monooxygenase has transmogrified significantly. Commencing in the 1960s, extensive initial studies consistently reported that the enzyme was a monomeric true flavoprotein dependent on both FMNH₂ and nonheme iron as bound cofactors. However, over the last decade all those criteria have changed absolutely, and the enzyme is currently acknowledged to be a metal ion-independent homodimeric flavin-dependent two-component monooxygenase deploying FMNH₂ as a cosubstrate. That transition is a paradigm of the ever evolving nature of scientific knowledge.

Experiments to measure a single molecule/particle, i.e. an individual molecule/particle, at room temperature or under physiological conditions without immobilization, for example on a surface, or without significant hydrodynamic flow have so far failed. This failure has given impetus to the underlying theory of Brownian molecular motion towards its stochastics due to diffusion. Quantifying the thermodynamic jitter of molecules/particles inspires many and forms the theoretical basis of single-molecule/single-particle biophysics and biochemistry. For the first time, our simulation results for a live cell (cytoplasm) show that the tracks of individual single molecules are localized in Brownian motion, while there is fanning out in fractal diffusion (anomalous diffusion).

Experiments to measure a single molecule/particle, i.e. an individual molecule/particle, at room temperature or under physiological conditions without immobilization, for example on a surface, or without significant hydrodynamic flow have so far failed. This failure has given impetus to the underlying theory of Brownian molecular motion towards its stochastics due to diffusion. Quantifying the thermodynamic jitter of molecules/particles inspires many and forms the theoretical basis of single-molecule/single-particle biophysics and biochemistry. For the first time, our simulation results for a live cell (cytoplasm) show that the tracks of individual single molecules are localized in Brownian motion, while there is fanning out in fractal diffusion (anomalous diffusion).

Air pollution, climate change and global warming show direct linkage. Introduction - Background: Research in the field has proposed and demonstrated their link to increased allergenicity in plants, leading to increased allergic diseases. Allergen patterns are changing in response to climate change. Across Europe, up to 12% of the population suffers from allergic diseases (bronchial asthma and allergic rhinitis) caused by the pollen grains. The medical costs of these types of allergies are enormous and are increasing with the spread of common ragweed - Ambrosia artemisiifolia* in Europe. In practice, more and more patients are turning to allergists. Methods: Based on these data, the research aims to identify safety measures and specific legislation to control and eradicate common ragweed in the countries most affected by the spread of this plant in Europe, increase in population exposure in countries affected by the presence of common ragweed and the socio-economic impact of allergic rhinitis and bronchial asthma at European level.[1][2] Our database search did not reveal any other research that has addressed this topic to date. Results: This research identifies specific legislation to the countries most affected by the spread of this plant pollen grains at European level, changes in allergen patterns and monitoring/safety eradication measures decided by local authorities, and data on the spread of common ragweed over the last two decades, costs per treatment, increased allergic rhinitis and bronchial asthma morbidity in the most affected areas. Conclusions: At European level, there are no universally valid models for eradicating this weed. Various methods can be used to limit the spread of common ragweed and its pollen production (e.g. mowing once or twice a year of overgrown land, ploughing, chemical control, public information, etc.). Local and regional cooperation should be considered essential to promote phytosanitary &amp; safety measures and exchange of information on methods to identify and manage the spread of common ragweed. Unified legislation at European level would help all affected countries; reduce morbidity from respiratory allergic diseases and the costs of treating these diseases.

Reducing CO2 emissions is urgently needed to slow down the impacts of climate change. CO2 capture using an amine solution has been developed and implemented on pilot and commercial scales. However, amine scrubbing, in particular, produces a lot of degraded solvent as waste and is energy intensive. Solid sorbents have been called to overcome those drawbacks. In this work, waste biomass-derived carbon materials were developed and tested for CO2 capture and conversion. Advanced thermal chemical processes i.e. hydrothermal and pyrolysis were applied to produce materials from agri-food waste such as soybean and okara. It was found that the number of functional groups (-C=O and -OH) in activated carbon appears in the synthesized materials, implying the generation of surface oxygenated groups. Preliminary results showed that the synthesized activated carbons are obtained with good yields, and a relatively high surface area, which may be applied as CO2 adsorption materials to solve the CO2 emission problems.

The Bacillus megaterium LVN01 species native to Colombia has demonstrated the ability to metabolize different co-products or industrial waste (such as fique juice, cane molasses, residual glycerol) and accumulate polyhydroxybutyrate (PHB), giving it potential in the bioplastics industry. In this research, the potential of liquid digestate as a carbon source for the production of PHA in fermentation processes with this bacterial strain was evaluated. Favorably, it was found that B. megaterium utilizes the nutrients from this residual substrate to multiply appropriately and efficiently synthesize poly(hydroxybutyrate-co-hydroxyvalerate) (PHBV). Bench scale aerobic batch fermentation, under the operational conditions of this research [Volume: 3L; Temperature: 30.8°C; Agitation: 400 rpm; pH: 7.0 ± 0.2; Disolved Oxygen: 100% saturation; Antifoam 10% (v/v)], generated maximum values of DCW (0.56 g cell L-1) at 60 h, while the maximum PHB yield (360 mg PHB L-1) occurred at 16 h, which is very favorable for sustainable degradable bioplastics production. Additionally, GC-MS and NMR analyses confirmed that the PHBV copolymer synthesized by B. megaterium is made up of the monomers 3-hydroxybutyrate (3HB) and 3-hydroxyvalerate (3HV). Furthermore, the thermal properties determined by TGA (Tonset=283.1 ºC, Tendset= 296.98 ºC. Td =290.114 °C) and DSC (Tm= ºC155.7 °C, ΔHf= 19.80 J g-1, Xcr = 18.17%), indicate that it is a thermally stable biopolymer with low percentages of crystallinity, providing flexibility that facilitates molding, adaptation, and application in various industrial sectors.

The Circular Bioeconomy (CBE) combines the concepts of bioeconomy and circular economy. As an alternative concept to the current fossil-based, linear economy, it de-scribes an economy based on the efficient valorization of biomass. It is regional in nature and aims to improve sustainability. An analysis of the transition process, by identifying its success criteria and assessing its impacts through the modelling of technology-specific scenarios is necessary to ensure that CBE concepts are sustainable. However, a compre-hensive consideration of regional influences on both is lacking. Based on extensive literature research and an expert survey, we (i) present a compre-hensive catalog of CBE success criteria and discuss their region-specific character and (ii) develop a methodology based on evaluation matrices that enable to match CBE technolo-gies with regions. The matrices support the evaluation of technological and regional characteristics influencing the successful CBE implementation. The results show that the success criteria "biomass resources", "technological", and "social" are perceived as highly important, and that most of the success criteria are both region- and technology-specific, highlighting the relevance of developing matrices to match them. We describe such matrices indicatively for the two broadest and most im-portant success criteria clusters “social acceptance” and “biomass supply chain”. With this, we substantiate the regional nature of CBE and raise the awareness on the importance of considering regional conditions in CBE transition processes. Furthermore, we provide practical guidance on how regional conditions can be reflected in the selection of technologies, e.g. in regional CBE technology scenarios.

The ultimate analysis parameters including carbon (C), hydrogen (H), nitrogen (N), and oxygen (O) content in biomass was rarely found to be predicted by nondestructive tests until to date. In this research, we developed partial least squares regression (PLSR) models to predict the ultimate analysis parameters of chip biomass using near infrared (NIR) raw spectra of non-wood and wood samples from fast growing tree and agricultural residue and nine different traditional spectral preprocessing techniques. These techniques include first derivative (sd1), second derivative (sd2), constant offset, standard normal variate (SNV), multiplicative scatter correction (MSC), vector normalization, min-max normalization, mean centering, sd1 + vector normalization, and sd1 + MSC. Additionally, we employed a genetic algorithm (GA), successive projection algorithm (SPA), multi-preprocessing (MP) 5−range, and MP 3−range to develop a PLSR model for rapid prediction. A dataset consisting of 120 chip biomass samples was utilized for model development in which the samples was non-wood samples of 65-67% and wood samples was 33-35%, and the model performance were evaluated and compared. The selection of the optimum performing model was mainly based on criteria such as the coefficient of determination in the prediction set (R2P), root mean square error of the prediction set (RMSEP), and the ratio of prediction to deviation values (RPD). The optimal model for weight percentage (wt.%) of C was obtained using GA−PLSR, yielding R2P, RMSEP, and RPD values of 0.6954, 1.1252 wt.%, and 1.8, respectively. Similarly, for wt.% of O, the most effective model was obtained using the multi-preprocessing PLSR−5 range method with R2P of 0.7150, RMSEP of 1.3088 wt.%, and RPD of 1.9. For wt.% of N, the optimal model was obtained using the MP PLSR−3 range method, resulting in R2P, RMSEP, and RPD values of 0.6073, 0.1008 wt.%, and 1.6, respectively. However, wt.% of H model provided R2P, RMSEP, and RPD values of 0.5162, 0.2322 wt.%, and 1.5, respectively. Notably, the limit of quantification (LOQ) values for C, H, and O were lower than the minimum reference values used during model development, indicating a high level of sensitivity. However, the LOQ for N, exceeded the minimum reference value, implying the samples to be predicted by the model must be in the range of reference range in calibration set. By scatter plot analysis, the effect of combined non-wood and wood spectra of biomass chips on rapid prediction of ultimate analysis parameters using NIR spectroscopy was investigated. To include different species in a model, the species have to be not only in the different values of the constituents to make a wider range for robust model but also they must provide their trend line characteristics in the scatter plot i.e. correlation coefficient (R), slope and intercept (same slope and slope approached to 1 and intercept is same (no gap) and approached zero, high R approached to 1). The effect of the R, slope and intercept to obtain the better optimized model were studied. The results show that the different species affected model performance of each parameter prediction in a different manner and by scatter plot analysis which of these species were affecting the model negatively and how the model could be improved was indicated. This is the first time of the effect is studied by the principle of scatter plot.

Mushroom production in Poland is an important and dynamically developing element of diverse agriculture. Mushroom spent compost (MSC) is major waste generated during production, i.e., MSC: mushrooms is ~5:1. To date, the main use of MSC is soil application as organic fertilizer. To date, several methods of MSC treatment have been researched and developed including production of compost, bioethanol, biogas, enzyme lactase, xylo-saccharides, and hydrogen. Torrefaction may be considered a novel approach for biomass valorization. Thus, we are pioneering the potential use of MSC valorization via torrefaction. We explored valorizing the waste biomass of MSC via thermal treatment – torrefaction (‘roasting’) to produce biochar with improved fuel properties. Here for the first time, we examined and summarized the MSC torrefaction thermogravimetric analyses, fuel properties data of raw biomass of MSC and biochars generated from MSC via torrefaction. The effects of torrefaction temperature (200~300 °C), process time (20~60 min), on fuel properties of the resulting biochars were summarized. The dataset contains results of thermogravimetric analysis (TGA) as well as proximate analyses of MSC and generated biochars. The presented data are useful in determining MSC torrefaction reaction kinetics, activation energy and to further techno-economical modeling of the feasibility of MSC valorization via torrefaction. MSC torrefaction could be exploited as part of valorization resulting from a synergy between an intensive mushroom production with the efficient production of high-quality renewable fuel.

As the EU is moving towards a low carbon economy and seeks to further develop its renewable energy policy, this paper quantitatively investigates the impact of plausible energy market reforms from the perspective of bio-renewables. Employing a state-of-the-art biobased variant of a computable general equilibrium model, this study assesses the perceived medium-term benefits, risks and trade-offs which arise from an advanced biofuels plan, two exploratory scenarios of a more 'sustainable' conventional biofuels plan and a 'no-mandate' scenario. Consistent with more recent studies, none of the scenarios considered present significant challenges to EU food-security or agricultural land usage. An illustrative advanced biofuels plan simulation requires non-trivial public support to implement whilst a degree of competition for biomass with (high-value) advanced biomass material industries is observed. On the other hand, it significantly alleviates land use pressures, whilst lignocellulose biomass prices are not expected to increase to unsustainable levels. Clearly, these observations are subject to assumptions on technological change, sustainable biomass limits, expected trends in fossil fuel prices and EU access to third-country trade. With these same caveats in mind, the switch to increased bioethanol production does not result in significant market tensions in biomass markets.

Surface area and pore size distribution of Eucalyptus samples pretreated by different methods were determined by the Brunauer-Emmett-Teller (BET) technique. Three methods were applied to prepare cellulosic biomass samples for BET measurements: air, freeze, and critical point drying (CPD). Air and freeze drying caused severe collapse of biomass pore structures, but CPD effectively preserved biomass morphology. Surface area of CPD prepared Eucalyptus samples was determined to be 58–161 m2/g, whereas air and freeze dried samples were 0.5–1.3 and 1.0–2.4 m2/g, respectively. Average pore diameter of CPD prepared Eucalyptus samples were 61–70Å. CPD preserved Eucalyptus sample morphology by replacing water with a non-polar solvent, CO2 fluid, which prevented hydrogen bond reformation in the cellulose.

The açaí (Euterpe oleracea Mart.) is a native fruit of the Amazon that is well-known due to its commercial value. Its production chain is centered in the state of Pará, largely supplied by extractivism. The processing of açaí fruits in nature generates huge amount of solid waste, which can pose serious risks to the environment if not used and managed properly. Due to a small number of systhematic studies on the effect of chemical activation by pyrolysis of açaí seeds and fibers, and with the aim of providing a basis for future applications of the waste generated by processing of açaí fruits, the present work proposes a study of the pyrolysis of açaí seeds and fibers and the physicochemical and compositional characterization of the aqueous phase products. In this way, açaí seeds were collected from a local artisan processing facility in the city of Belém, PA. The seeds were dried at 105°C until constant weight, and subsequently, the fibers were separated from the seeds in a rotating drum. The seeds and fibers were impregnated with NaOH solutions at 0.5M, 1.0M, and 2.0M, and then pyrolyzed at a laboratory scale at 450 °C and 1 atm. The liquid products from pyrolysis were characterized through acidity index analysis, Fourier-transform infrared spectroscopy, and gas chromatography. The increase in the concentration of the impregnating agent resulted in an increase in bio-oil yield from both the seeds and fibers, rising from 3.3% (raw seeds) to 6.6% (seeds impregnated with 2M NaOH) and from 1.2% (raw fibers) to 3.7% (fibers impregnated with 2M NaOH). The yield in the aqueous phase after biomass pyrolysis showed an inverse behavior to the bio-oil yield, decreasing from 33.7% (raw fibers) to 21.2% (fibers impregnated with 2M NaOH) and from 41% (raw seeds) to 37.5% (seeds impregnated with 2.0M NaOH). High acidity levels were found in the aqueous phase samples and bio-oils derived from the seeds and fibers, which decreased as the concentration of the impregnating agent increased. The increase in the concentration of the impregnating agent (NaOH) influenced the chemical composition of the obtained liquid products, leading to a decrease in oxygenated compounds and an increase in nitrogenous compounds in both experimental matrices, which was also evidenced by the reduction in acidity.

The global energy crisis is a significant issue, particularly in developing countries like Ethiopia, where traditional fuels such as wood and charcoal are predominantly used to meet energy demands in urban and rural areas. Despite Ethiopia's substantial charcoal production, the use of inefficient charcoal cookstoves exacerbates fuel consumption, forest degradation, and environmental damage. To address this, various improved charcoal cookstoves (ICS) have been introduced in urban and semi-urban communities in Wereta Town, located in the Amhara Regional State of Ethiopia. This study aims to evaluate household perceptions and identify barriers to the adoption of ICS in the Wereta district. The assessment involved a survey of 308 households using a structured cross-sectional method and analyzed five types of improved cookstoves: clay stoves, insulated clay cylinder stoves, non-insulated rocket stoves, insulated rocket stoves, and non-insulated cylindrical stoves. The study employed various socio-economic variables and utilized both cross-tabulation frequency factors and linear regression statistical analysis through SPSS 20 to identify factors influencing the adoption of ICS. The linear regression results indicated that marital status, income level, family size, and age significantly impact ICS adoption (p-value < 0.05), while the place of cooking, educational level, household decision-making, and the role of societal stakeholders showed no significant impact. This suggests that ICS adoption is primarily influenced by household income levels and family size.

This study analyzed the CO2 capture potential for Parque Natural Regional Serrania de las Quinchas buffer area in Colombia. For this purpose, multitemporal analysis for land covering for years 1989, 2000, 2006, 2011, 2017 and 2021 was made using the Normalized Difference Vegetation Index (NDVI), and Corine Land Cover (CLC) methodology. In the same way, Aboveground Biomass (AGB) was measured for representative parcels by measuring tree’s diameters and heights and applying the adequate allometric models; carbon content in soils was measured too. Results show that dense forest has grown since 1989 and the carbon stock in all the vegetation covers increased by 14,3% from 1989 until 2021, using literature data for tropical humid forests. If measured AGB values obtained in this study are used, the carbon stock average is 3 times this value. Measured carbon average content in AGB was 374,3 Ton C/Ha, well above the average for the content reported for humid tropical forests in Colombia; carbon content in soils was 897,19 Ton/Ha, 2,4 times that found in the AGB. In total, an average of 1271,49 Ton C/Ha (AGB+ soil) was found and a pattern of dense forest recovery was found, but in a more dispersed way than in the past. A very interesting potential for existing forests recovery was found for this area. Strategies for this include the development of sustainable practices, land use management, everything pursuing biodiversity preservation and the participation and leading of the local communities.

“Blue carbon”, apart from marine humus, includes the carbon (C) stock of coastal ecosystems such as mangroves, marshes, and seagrass meadows, which have been overlooked until recently. Information about the role of coastal wetlands in C sequestration and providing other ecosystem services is still insufficient. In the present study, we assessed the C reserves of soils and vegetation biomass in two complex coastal landscapes (tombolos) located on the coasts of the White and Baltic seas. The soil and plant C stocks were slightly higher at the plot at the Baltic Sea (93.4 ± 46.7 Mg C·ha-1 and 5.22 ± 2.51 Mg C·ha-1, respectively) than at the plot on the White Sea (71.4 ± 38.2 Mg C·ha-1 and 3.95 ± 2.42 Mg C·ha-1, respectively). We attributed the higher values of the C reserved to a warmer climate and less saline water at the plot on the Baltic Sea. Both soil and plant C showed high heterogeneity due to geomorphological complexity and differences in vegetative communities. The Phragmites australis community showed the highest plant biomass and, in some places, high soil C reserves. Allochthonous C contributed to the soil C stock at the site on the White Sea. Though P. australis sequestered more C than other communities, its effect on ecosystem services was mostly negative because the invasion of reeds reduced the biological diversity of the marshes.

Precision farming, a labor-saving and highly productive management, is gaining popularity as the number of farmers declines in contrast to the increasing global food demand. However, it requires more efficient crop phenology observation and growth monitoring. One measure is the Leaf Area Index (LAI), which is essential for estimating biomass and yield, but its validation requires destructive field measurements. Remote sensing offers a non-destructive and effective method for ground- and UAV-based field observations. Thus, in this study, a method for indirect estimation of LAI was investigated using ground and UAV observation data. A weekly plant survey was done to measure the plant height, above-ground biomass, and light intensity. Furthermore, images from ground-based and UAV-based cameras were acquired to generate NDVI and the canopy height (CH), respectively. Using the canopy photosynthetic model, derived from Lambert-Beer’s law, the daily biomass was estimated by applying the weekly estimated LAI using CH, and the observed light intensity data as input. The results demonstrated the possibility of quantitatively estimating the daily growth biomass of rice plants, including its spatial variation. The near-real-time estimation method of rice biomass by integrating observation data at fields with numerical models can be applied to the management of major crops.

Through the use of machine learning algorithms like the Support Vector Machine, it has been show that burn extent can be accurately mapped from hyperspatial drone imagery in both grasslands and forests. Despite these successes, hyperspatial imagery must be acquired via drones, requiring large amounts of time and resources to capture areas much smaller than the large catastrophic fires which result in the majority of the lands burned each year by wildland fires. To overcome this difficulty, high spatial resolution satellite imagery from Worldview2 can be substituted for hyperspatial drone imagery, allowing for larger regions of images to be acquired more easily and efficiently. Additionally, Worldview2 trades spatial resolution for spectral resolution and extent, capturing images in 8 multispectral bands as opposed to 3 band imagery in the visible spectra. This research examines the utility of each of the 8 bands observed in Worldview2 imagery using an Iterative Dichotomiser 3 decision tree, then uses these bands to map burn extent and biomass consumption. Several classifications of burn extent and biomass consumption are produced and compared based on the bands used as inputs. The results show that using Worldview2 imagery to map burn extent and biomass consumption results in highly accurate maps, with slight improvements when additional bands are added.

The new climate law introduces a policy of sustainable construction, the assumption of which is the reduction of CO2 by the construction industry and the use of environmentally friendly materials, such as agricultural, mineral, and recycled waste, while limiting the consumption of natural resources. The article is a literature review that analyzes selected waste materials from various sectors of the economy that can be used as additives or partial substitutes for natural resources in the production of cement and in and cement building materials, the production of which reduces CO2 emissions, producing materials with high mechanical strength and environmentally friendly.

The development of platinum group metal-free (PGM-free) electrocatalysts derived from cheap and environmentally friendly biomasses for oxygen reduction reaction (ORR) is a topic of relevant interest, particularly from the point of view of sustainability. Fe-nitrogen-doped carbon materials (Fe-N-C) have attracted particular interest as alternative to Pt-based materials, due to the high activity and selectivity of Fe-Nx active sites, the high availability and good tolerance to poisoning. Recently, many studies focused on developing synthetic strategies, which could transform N-containing biomasses into N-doped carbons. In this paper chitosan was employed as a suitable N-containing biomass for preparing Fe-N-C catalyst in virtue of its high N content (7.1%) and unique chemical structure. Moreover, the major application of chitosan is based on its ability to strongly coordinate metal ions, a precondition for the formation of Fe-Nx active sites. The synthesis of Fe-N-C consists in a double step thermochemical conversion of a dried chitosan hydrogel. In acidic aqueous solution, the preparation of physical cross-linked hydrogel allows to obtain sophisticated organization, which assure an optimal mesoporosity before and after the pyrolysis. After the second thermal treatment at 900 °C, a highly graphitized material was obtained, which has been fully characterized in term of textural, morphological and chemical properties. RRDE technique was used for understanding the activity and the selectivity of the material versus the ORR in 0.5 M H2SO4 electrolyte. Special attention was put in the determination of the active site density according to nitrite electrochemical reduction measurements. It was clearly established that the catalytic activity expressed as half wave potential linearly scales with the number of Fe-Nx sites. It was also established that the addition of the iron precursor after the first pyrolysis step leads to an increased activity because of both an increased number of active sites and of a hierarchical structure, which improves the access to active sites. At the same time, the increased graphitization degree, and a reduced density of pyrrolic nitrogen groups are helpful to increase the selectivity toward the 4e- ORR pathway.

This paper presents ensemble learning of multi-source satellite sensors dataset to obtain better predictive performance of the forest biomass. Spectral, spectral-indices, and spectral-textural features were generated from two optical satellite sensors, Landsat 8 Operational Land Imager (OLI) and Sentinel-2 Multispectral Instrument (MSI). In addition, two radar satellite sensors, Sentinel-1 C-band Synthetic Aperture Radar (CSAR), and Advanced Land Observing Satellite (ALOS-2) Phased Array type L-band Synthetic Aperture Radar (PALSAR-2) were utilized to generate backscattering and backscattering-textural features. The plot-wise above ground biomass data available from five forests in New England region were utilized. Ensemble learning of multi-source satellite sensors dataset was carried out by employing four machine learning regressors namely, Support Vector Machines (SVM), Random Forests (RF), Gradient Boosting (GB), and Multilayer Perceptron (MLP). A five-fold cross-validation method was used to evaluate predictive performance of the multi-source satellite sensors. The integration of multi-source satellite features, comprising of spectral, spectral-indices, backscattering, spectral-textural, and backscattering-textural information, through ensemble learning and cross-validation approach implemented in the research showed promising results (R² = 0.81, RMSE = 46.2 Mg/ha) for the estimation of plots-level forest biomass in New England region.

Reduced nutrient mineralization rates under minimum tillage are usually compensated by mineral fertilizer application. These cannot be applied in organic farming systems, however. We hypothesized that organic minimum tillage based on frequent cover cropping and application of dead mulch will improve soil fertility and can compensate for the potential negative effects of minimum tillage. Two long-term field experiments were set up in 2010 and 2011 comparing plough versus minimum tillage including application of transferred mulch. As second factor, the application of compost versus mineral potassium and phosphorus was compared. In 2019, soils were analyzed for soil pH, organic carbon, macro-, micronutrients, microbial biomass, microbial activity and total nematode abundance. In addition, performance of pea in the same soils was determined under greenhouse conditions. Across both experiments, macronutrients (+52%), micronutrients (+11%), microbial biomass (+51%), microbial activity (+86%), and bacterivorous nematodes (+112%) increased in minimum tillage compared with the plough-based system. In the greenhouse, pea biomass was 45% higher in the soil that had been subjected to minimum tillage compared to the plough. In conclusion, soil fertility can be improved in organic minimum tillage systems by intensive cover cropping and application of dead mulch to levels higher than in a plough-based system.

Strip-mined land (SML) disturbed by coal-mining is the non-crop land resource that can be utilized to cultivate high-yielding energy crops such as miscanthus for bioenergy applications. However, the biomass yield potential, annual availability and environmental impacts on growing energy crops in SML are less understood. In this study, we estimated the yield potential of miscanthus (Miscanthus sinensis) in SML and its environmental impacts on local streams using the Soil and Water Assessment Tool (SWAT). After calibration and validation of the SWAT model, the results demonstrated that miscanthus yield potentials were 2.6 (0.8−5.53), 10.0 (1.3−16.0) and 16.0 (1.34−26.0) Mg ha^-1 with the fertilizer application rate of 0, 100, and 200 kg-N ha^-1 respectively. Furthermore, cultivation of miscanthus in the SML has the potential to reduce sediment (~20%) and nitrate (2.5%−10.0 %) loads reaching to water streams with a marginal increase in phosphorus load. The available SML in the United States could produce about 10 to 16 dry Tg of biomass per year without negatively impacting the water quality. In conclusion, SML can provide a unique opportunity to produce biomass for bioenergy applications, while improving stream water quality in highly dense mining area (the Appalachian region) in the United States.

In this short review paper we have assembled the main characteristics of partial oxidation reactions (oxidative dehydrogenation and selective oxidation to olefins or oxygenates, as aldehydes and carboxylic acids and nitriles), as well as total oxidation, particularly for depollution, environmental issues and wastewater treatments. Both gas-solid and liquid-solid media have been considered with recent and representative examples within these fields. We have also discussed about their potential and prospective industrial applications. Particular attention has been brought to new raw materials stemming from biomass and to liquid-solid catalysts cases. This review paper also summarizes the progresses made in the use of unconventional activation methods for performing oxidation reactions, highlighting the synergy of these technologies with heterogeneous catalysis. Focus has been centered on usual catalysts activation methods but also on less usual ones, such as the use of ultrasounds, microwaves, grinding (mechanochemistry) and photo-activated processes, as well as their combined use.

Understory plants are important components of forest ecosystem productivity and diversity. Compared to biomass models of overstory canopy trees, few are available for understory saplings and shrubs and therefore their roles in estimation of forest carbon pools are often ignored. In this study, we harvested 24 understory species including 4 saplings, 9 tree-like shrubs and 11 typical shrubs in coniferous and broadleaved mixed forest in northeastern China and developed the best fit allometric equations of above- and below-ground and total biomass by species-specific or multispecies using morphological measurements of basal diameter, height and crown area as independent variables. The result showed that single basal diameter, height or crown area had good explanatory power for both species-specific and multispecies (p<0.001). The best-fit models included only basal diameter in sapling and tree-like shrubs, and combinations of crown area, height, and basal diameter in typical shrubs. The logarithmic model was most desired among the 4 model forms of linear, quadratic, multiple linear and logarithmic, for species-specific and multispecies. The models we developed should help the estimation of forest ecosystem carbon stocks, especially for belowground component, and provide tools for quantification of individual species biomass of understory plants.

The present study evaluates mold fungal resistance of newly developed loose-fill thermal insulation materials from wheat straw, corn stalk and water reed. Three different processing methods of raw materials was performed by mechanical crushing (Raw, ≤ 20 mm), thermal-mechanical pulping (TMP) using 4% NaOH and steam explosion pulping (SEP). An admixture of boric acid (8%) and tetraborate (7%) was applied to all processed substrates due to their anti-fungal properties. Additionally, the fourth sample group was prepared from SEPs of all raw species without boric acid and tetraborate (SEP*) as control. Samples from all treatments were separately inoculated by 5 different fungal species and incubated in darkness for 28 days at 28 ℃ and RH &gt;90%. The highest resistance to the colonization of mold fungi was achieved by TMP and SEP processing coupled with addition of boric acid and tetraborate, where molds infest only around 35% to 40% of the inoculated sample area. The lowest mold fungi resistance was detected for Raw and SEP* samples, each ~75% that was affected by rich amount of accessible nutrients, suggesting that boric acid and tetraborate additives alone did not prevent mold fungal growth as effective as in combination with TMP and SEP treatments. Together, the achieved fungal colonization scores after combined fungicide and pulping treatments are acceptable for the application of various renewable materials in future thermal insulation product development.

We present a novel passive satellite remote sensing approach for observing the three-dimensional distribution of aerosols emitted from wildfires. This method, called AEROS5P, retrieves vertical profiles of aerosol extinction from measurements of the TROPOMI satellite sensor onboard the Sentinel 5 Precursor mission. It uses a Tikhonov-Phillips regularization which iteratively fits cloud-free near-infrared and visible selected reflectances to simultaneously adjust the vertical distribution and abundance of aerosols. The information on the altitude of the aerosol layers is provided by TROPOMI measurements of the reflectance spectra at the oxygen A-band near 760 nm. In the present paper, we use this new approach for observing the daily evolution of the three-dimensional distribution of biomass burning aerosols emitted by Australian wildfires on 20-24 December 2019. Aerosol optical depths (AOD) derived by vertical integration of the aerosol extinction profiles retrieved by AEROS5P are compared with MODIS, VIIRS and AERONET coincident observations. They show a good agreement in the horizontal distribution of biomass burning aerosols, with a correlation coefficient of 0.86 and a mean absolute error of 0.2 with respect to VIIRS. A fair agreement is found between coincident transects of vertical profiles of biomass burning aerosols derived from AEROS5P and from the CALIOP spaceborne lidar. The mean altitude of these aerosols derived from these two measurements show a good agreement, with a small mean bias (185 m) and a correlation coefficient of 0.83. Moreover, AEROS5P observations reveal the height of injection of the biomass burning aerosols in 3D. The highest injection heights during the period of analysis are coincident with the largest fire radiative power derived from MODIS. Consistency is also found with respect to the vertical stability of the atmosphere.

Currently, energy security and environmental degradation are the two biggest challenges before humanity that can be surmounted with the use of green and sustainable biofuels produced from lignocellulosic crops. In the future, to ensure adequate and cost-effective supply of biofuels, it requires a sufficient amount of amenable and quality lignocellulosic feedstocks. Therefore, agricultural yields of lignocellulosic biomass crops should be substantially increased by intense genetic maneuvering of key gene regulatory mechanisms and signaling pathways that control plant biomass yield. Recently, numerous miRNAs families are identified, characterized, and validated across the plant kingdom. Plant microRNAs (miRNAs) are 21 to 24 nucleotides long, non-coding small RNAs, act as regulators of their target genes via inducing modifications in transcription, translation, and epigenome. MiRNAs represent many hallmark characteristics like sequence-specific regulation, tissue, and species-specific expression, evolutionary conservation, and functional diversity. They coordinate well physiological and life cycle processes in plants under adverse environmental conditions. Hence, miRNAs offer accurate, precise, and efficient regulatory switches in the miRNA-targeted genetic networks. It is evident from the study of the miR156 family and its target SQUAMOSA PROMOTER BINDING PROTEIN-LIKE (SPL) genes network that controls highly significant agronomic traits in crop plants. The miR156/SPL module acts as a master circuit that synchronizes many intricate complex biological functions such as growth and development, and metabolic processes by sensing internal and external environmental signals in plants. Therefore, miR156 can prove a potential target for miRNAs based plant biotechnology to harmonize complex biofuel traits and improve biomass yield in lignocellulosic biomass crops.

The status of tropical fisheries is poorly known because the existing methodological choices have variable outcomes and recommendations. Therefore, multiple approaches to estimating sustainability were compared, namely fisheries independent stock biomass and recovery rates, fisheries dependent landed catches, balanced harvest and gear use metrics, and fish length measurements. Unfished biomass recovery time series was established by a 45-year stock recovery relationship from 7 fisheries reserves and compared to catch and length-based estimates of sustainability. The logistic production rates (r = 0.10 ± 0.06 95% CI) and maximum equilibrium total biomass (150 ± 30 tons/km²) indicated a broad range of potential maximum sustainable yields but likely ranging from 1.1 to 3.9 (95% CI; mean = 3.8) tons/km²/year. In contrast, mean annual biomass growth rates in reserves was lower but less variable than surplus production estimates, ranging from 2.1 to 3.5 (mean=2.8 tons/km²/year). Realized catches at landing sites was lower still, ranging from 1.43 to 1.52 (mean=1.48± 0.2 tons/km²/y). Differences were largely attributable to changes in taxonomic composition and an imbalance in the proportionality of production potential versus actual capture rates. Differences in the vulnerability of taxa to fishing and a lack of compensatory increased production among fishing resistant taxa could largely account for the lost potential production. Large proportional losses of catch were measured among snappers, unicorn fish, sweetlips, goatfish, and soldierfish, while smaller proportional gains in the catch were found among resident herbivorous rabbitfish, parrotfish, and groupers. Many of these declining taxa had vulnerable schooling life histories likely to require special habitat and reserve characteristics. Evaluations of sustainability from length measurements found 17 or 7% of total and 12% of caught species had a minimum sufficient sample sizes (>30 individuals, 413 catches, 2299 individuals, and 144 species) to evaluate length and spawning metrics of sustainability. Seven of these species met length-based and 3 meet spawning potential ratio thresholds for sustainability. Consequently, length-based evaluations were unable to evaluate the sustainability of the larger community. Recommendations include a management focus on the recovery of “ghost taxa”, species abundant in the oldest reserve but not contributing to fisheries yields.

Forest degradation is known to be widespread in the tropics, but is currently very poorly mapped, in part because there is little quantitative data on which satellite sensor characteristics and analysis methods are best at detecting it. To improve this, we used data from the Tropical Forest Degradation Experiment (FODEX) plots in the southern Peruvian Amazon, where different numbers of trees had been removed from four 1 ha forest plots, carefully inventoried by hand and Terrestrial Laser Scanning before and after the logging to give a range of biomass change (ΔAGB) values. We conducted a comparative study of six multispectral optical satellite sensors (WorldView-3, SkySat, SPOT-7, PlanetScope, Sentinel-2 and Landsat 8) at 0.3 – 30 m spatial resolution, to find the best combination of sensor and remote sensing indicator for change detection. Spectral reflectance, the Normalized Difference Vegetation Index (NDVI) and texture parameters were extracted after radiometric calibration and image preprocessing. The strength of the relationships between the change in these values and field-measured ΔAGB (computed in % ha−1) was analysed. The results demonstrate that: (a) texture measures correlates more with ΔAGB than simple spectral parameters; (b) the strongest correlations are achieved for those sensors with spatial resolutions in the intermediate range (1.5 - 10 m), with finer or coarser resolutions producing worse results, and (c) when texture is computed using a moving square window ranging between 9 - 14 m in length. Maps predicting ΔAGB showed very promising results using a NIR-derived texture parameter for 3 m resolution PlanetScope (R2 = 0.97 and RMSE = 1.80 % ha−1), followed by 1.5 m SPOT-7 (R2 = 0.74 and RMSE = 5.25 % ha−1) and 10 m Sentinel-2 (R2 = 0.71 and RMSE = 5.55 % ha−1). Texture models derived from 0.3 m WorldView-3 improved with increasing window size, with highest R2 of 0.62 and RMSE = 6.35 % ha−1 for a window of 14 m in length. The degradation in our field plots is invisible to the 30 m resolution Landsat data. Our findings imply that, at least for lowland Peru, low-medium intensity disturbance can be detected best in optical wavelengths using a texture measure derived from 3 m PlanetScope data. That such data are being collected daily, and currently released free as monthly mosaics over tropical forests as part of the Norway’s International Climate and Forest Initiative (NICFI), is excellent news for monitoring such degradation.

Ethanol produced from various biobased sources (bioethanol) has been gaining high attention lately due to its potential to cut down net emissions of carbon dioxide while reducing burgeoning world dependence on fossil fuels. Global ethanol production has increased more than six-fold from 18 billion liters at the turn of the century to 110 billion liters in 2019 (1,2). Sugar cane and corn have been used as the major feedstocks for ethanol production. Lignocellulosic biomass has recently been considered as another potential feedstock. This paper reviews recent developments and current status of commercial production of ethanol across the world. The review includes the ethanol production processes used for each type of feedstock, both currently practiced at commercial scale and newly developed technologies, and production trends in various regions and countries in the world.

Morphological parameters like cotton height, branches, Leaf Area Index and biomass are mainly affected by the vegetation water content (VWC). Periodical assessment of the VWC and crop parameters is required for timely management of the crop for maximizing yield. The study aimed at using both optical and microwave remotely sensed data to assess cotton crop condition based on the above mentioned traits. Vegetation indices (VI) derived from ground based measurements (5 narrow band and 2 broad band VIs) as well as satellite derived reflectance (2 broad band VIs) were assessed. Regression models were derived for estimating LAI, biomass and plant water content using the ground based indices and applied to the satellite derived spectral index (from LISS-III) map to estimate the respective parameters. HH and HV polarization from RISAT-1 were used to derive Radar Vegetation Index (RVI). The coefficient of determination of the model for estimating LAI, biomass and vegetation water content of cotton with optical vegetation index as input parameter were found to be 0.42, 0.51 and 0.52, respectively. The correlation between RVI and plant height, date of planting in terms of the age of the crop and vegetation water content were found to range between 0.4 to 0.6. The fresh biomass from RVI showed spatial variability from 100 gm-2 to 4000 gm-2 while the dry biomass map derived from NDVI showed spatial variability of 50 to 950 g m-2 for the study area. Plant water content in the district varied from 65 to 85%. The correlation between optical vegetation index and RVI was not significant. Hence a multiple linear regression model using both optical index (NDVI and LSWI) and SAR index (RVI) was developed to assess the LAI, biomass and plant water content. The model showed a R2 of 0.5 for LAI estimation but not significant for biomass and water content. This study show cased the use of combined optical and microwave (C band) remote sensing for cotton condition assessment.

Abstract: Objective: analyze the effectiveness of the implementation of the Lean Healthcare sys-tem at the emergency room of the Clinical Hospital of the Federal University of Uberlândia (HC-UFU), based on a comparison of hospital indicators obtained over the three phases corre-sponding to the period of one year before the implementation (T1), the year during the imple-mentation (T2) and one year after implementation (T3). Material and Methods: this is applied research, classified as a case study, exploratory, descriptive that is developed in stages. Based herein on the search for hospital indicators, as occurred in the implementation process of Lean in Emergencies at the HC-UFU and a description of the implemented Lean system. Results and Discussions: during the period where it was possible to collect data relevant to the NEDOCS and LOS indicators, the motivation of the teams grew, but with a notable tension between municipal management and hospital management. It was found that, despite the fluctuations, the patient length of stay in the Emergency Room remained high. Noteworthy here is that with the excep-tion of the variable of female deaths before 24 hours of hospitalization, all other variables showed percentage increases before and after the intervention. Conclusion: the methodology followed for the implementation of Lean in Emergencies in the emergency sector of the hospital did not produce an improvement in hospital indicators.

Expectation maximization (EM) algorithm is a powerful mathematical tool for estimating statistical parameter when data sample contains hidden part and observed part. EM is applied to learn finite mixture model in which the whole distribution of observed variable is average sum of partial distributions. Coverage ratio of every partial distribution is specified by the probability of hidden variable. An application of mixture model is soft clustering in which cluster is modeled by hidden variable whereas each data point can be assigned to more than one cluster and degree of such assignment is represented by the probability of hidden variable. However, such probability in traditional mixture model is simplified as a parameter, which can cause loss of valuable information. Therefore, in this research I propose a so-called conditional mixture model (CMM) in which the probability of hidden variable is modeled as a full probabilistic density function (PDF) that owns individual parameter. CMM aims to extend mixture model. I also propose an application of CMM which is called adaptive regressive model (ARM). Traditional regression model is effective when data sample is scattered equally. If data points are grouped into clusters, regression model tries to learn a unified regression function which goes through all data points. Obviously, such unified function is not effective to evaluate response variable based on grouped data points. The concept “adaptive” of ARM means that ARM solves the ineffectiveness problem by selecting the best cluster of data points firstly and then evaluating response variable within such best cluster. In order words, ARM reduces estimation space of regression model so as to gain high accuracy in calculation.

Corona viruses hijack human enzymes to assembly sugar coat on Spike glycoproteins. The mechanism that human antibodies may uncover the antigenic viral peptide epitopes hidden by sugar coat are unknown. In this study, we analyzed recombinant SARS-CoV-2 Spike protein secreted from BTI-Tn-5B1-4 cells, by trypsin and chymotrypsin digestion followed by mass spectrometry analysis. We acquired MS/MS spectrums for glycopeptides of all 22 predicted N-glycosylated sites. We further analyzed the surface accessibility of Spike proteins according to Cryo-EM and homolog-modeled structures, and available antibodies that bind to SARS-CoV-1. The results showed that all 22 N-glycosylated sites of SARS-CoV-2 are modified by high-mannose type of N-glycans. MS/MS fragmentation clearly established the glycopeptide identities. Electron densities of glycans cover most of the Spike receptor binding domain of SARS-CoV-2, except YQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQ, similar to a region FSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQ in SARS-CoV-1. Other surface-exposed domains included those located on Central Helix, between amino acids 967 and 1016 of SARS-CoV-1, and 985 to 1034 of SARS-CoV-2 Spike protein. As the majority of antibody paratopes bind to peptide portion with or without sugar modification, we propose a snake-catcher model that a minimal length of peptide is first clamped by a paratope, and the binding is either strengthened by sugars close to peptide, or not interfered by sugar modification.

Giant plasmonic surface enhancement has been observed in gold coated micron sized inverse pyramids entrapping a gold nanoparticle. The amplification of both surface enhanced Raman and photoluminescence signals was found to be dependent on the diameter of trapped gold nanoparticle and around 50-fold enhancement was detected for 250nm diameter sample relatively to the 50nm one. Finite differential time domain simulations, performed to determine the near-field distribution in the structure, showed that when the nanoparticle protrudes into the hotspot zone of the void, coupling of electromagnetic field occurs and the plasmon-related near-field enhancement is concentrated into the close vicinity of the nanoparticle, mainly into the close gaps around the tangential points of the curved sphere and the flat pyramid surface. This results in a more than 15 times increase of the near-field intensity, compared to the empty void.

Texas cotton production is facing challenges arising from increased temperatures and extended droughts. One potential solution to mitigate these environmental stresses lies in enhancing soil health through measures aimed at increasing soil organic matter and microbial biomass. Our field study investigated the effectiveness of adding residue on soil surface to increase soil organic matter content, microbial biomass, and cotton production under experimental warming with open-top chambers (OTCs). The OTCs raised the air temperature by 2 °C but did not affect soil temperature. OTCs also increased microbial biomass and soil respiration rate. Residue addition increased moisture content in non-irrigated (i.e., dryland) soils under experimental warming and concurrently reduced the daily temperature range in warmed plots. Furthermore, residue addition increased microbial biomass and soil respiration, particularly under OTC treatments in dryland soils. We also observed increased soil organic matter, microbial biomass, cotton biomass, and yield in irrigated fields compared to dryland. Our findings suggest that residue retention can mitigate the adverse effects of warming by stabilizing soil microclimate and enhancing soil organic matter and microbial biomass levels, especially in drylands. This, in turn, can help attenuate the potential impacts of future climate change on soil health and crop production in semiarid environments.

Three significant changes have occurred in the winter climate in Europe recently: increased UK flooding; Iberian drought; and warmer temperatures north of the Alps. The literature links all three to a persistent, significant increase in sea level pressure over Southern Europe, the Mediterranean, Iberia and the Eastern Atlantic (SEMIEA) which changes the atmospheric circulation system: forcing cold fronts to the north away from Iberia; and creating a south westerly flow around the northern perimeter of the high-pressure region bringing warmer, moist air from the subtropical Atlantic to the UK and Europe which increases precipitation in the UK and raises the temperature in Europe. I use the Last Millennium Ensemble, MERRA-2 and Terra-NCEP data to demonstrate that the extreme, anthropogenic, West African aerosol Plume (WAP) which only exists from December to April perturbs the northern, regional Hadley Circulation creating the high pressure in the SEMIEA. I also show that the anthropogenic WAP has only existed in its extreme form in recent decades as the two major sources of the WAP aerosols: biomass burning; and gas flaring have both increased significantly since 1950 due to: a four-fold increase in population; and gas flaring rising from zero to 7.4 billion m3/annum and note that this time span coincides with the changes in the three elements of the winter climate of Europe. I also suggest that it may be possible to eliminate the WAP and return the winter climate of Europe to its natural state after the crucial first step of recognising the cause of the changes is taken.

Current satellite remote sensing methods struggle to detect and map forest degradation, a critical issue as it is likely a major and growing source of carbon emissions and biodiveristy loss. TanDEM-X InSAR phase height (hϕ) is a promising variable for measuring forest disturbances, as it is closely related to mean canopy height, and thus should decrease if canopy trees are removed. However, previous research has focused on relatively flat terrain, despite the fact that much of the worlds’ remaining tropical forests are found in hilly areas, and this inevitably introduces artifacts in sideways imaging systems. In this paper, we find a relationship between hϕ and aboveground biomass change in four selectively logged plots in a hilly region of central Gabon. We show that minimising the level of multilooking in the interferometric processing chain strengthens this relationship, and that degradation estimates across steep slopes in the surrounding region are improved by selecting data from the most appropriate pass directions on a pixel-by-pixel basis. This shows that TanDEM-X InSAR can measure the magnitude of degradation, and that topographic effects can be mitigated if data from multiple SAR viewing geometries are available.

Peat is the main type of peloid used in Polish cosmetic/healing spa facilities. Depending on treatment and origin, peat waste can be contaminated microbiologically, and as result, it has to be incinerated in medical waste incineration plants without energy recovery (local law). Such a situation leads to peat waste management costs increase. Therefore in this work, we checked the possibility of peat waste upcycling to carbonized solid fuel (CSF) using torrefaction. Torrefaction is a thermal treatment process that removes microbiological contamination and improves the fuel properties of peat waste. In work torrefaction conditions (temperature and time) on CSF quality were tested. Parallelly, peat decomposition kinetics using TGA, and torrefaction kinetics with lifetime prediction using macro-TGA were determined. Furthermore, torrefaction theoretical mass and energy balance were determined. The results of the tested peat were compared with reference material (wood), and as result, obtained data can be used to adjust currently used wood torrefaction technologies for peat torrefaction. The results show that torrefaction can improve the high heating value of peat waste from 19.0 MJ x kg-1 to 21.3 MJ x kg-1, peat main decomposition takes place at 200-550 °C following second reaction order (n=2), with an activation energy of 33.34 kJ x mol-1 and pre-exponential factor of 4.40 x 10-1 s-1. Moreover, DSC analysis revealed that peat torrefaction required slightly more energy than wood torrefaction, and macro TGA showed that peat torrefaction has lower torrefaction constant reaction rates (k) than wood 1.05 x 10-5 - 3.15 x 10-5 vs 1.43 x 10-5 - 7.25 x 10-5 s-1.

Poland is the 3^rdproducer of mushrooms in the world. Mushroom production in Poland accounts for nearly 25% of the total production in the EU, and it is still growing. One type of waste generated during mushroom production is mushroom spent compost (MSC), with a 5:1 (MSC: mushrooms) production rate. We investigated valorizing the MSC to produce fuel via torrefaction (‘roasting’, a.k.a. low-temperature pyrolysis). Specifically, we developed models for the MSC torrefaction kinetics using thermogravimetric analyses (TGA) and the effects of torrefaction temperature (200~300 °C) and process duration time (20~60 min) on the resulting biochar (fuel) properties. The estimated activation energy value of MSC torrefaction was 22.3 kJ^.mol^-1. The highest higher heating value(HHV) = 17.9 MJ^.kg^-1d.m. was found for 280 °C (60 min torrefaction time). The temperature of torrefaction significantly (p<0.05) increased the HHVfor constant process duration. The torrefaction duration time significantly (p<0.05) increased the HHVfor 220 °C and decreased HHVfor 300 °C. The highest mass yield 98.5% was found for 220 °C (60 min), while the highest energy yield was found for 280 °C (60 min). In addition, estimations of the value (€132.3·Mg^-1d.m. or 27.7 €·Mg^-1w.m) and quantity of resulting biochar (from torrefied MSC with 65.3% moisture content) were made based on the 280°C (60 min) torrefaction variant, assuming the price of commercially available coal fuel. We have shown a concept for an alternative utilization of abundant biowaste (MSC). The initial economic evaluation showed that MSC torrefaction might be profitable. This research provides a basis for alternative use of an abundant biowaste and can help charting improved, sustainable mushroom production.

Polymer-based (nano)composite foams, especially those having a microcellular structure, containing suitable conductive (nano)fillers, have been shown to act as good shielding materials, hence coming as promising to act as shields in electronic devices, limiting/avoiding electromagnetic interference (EMI) pollution. Nevertheless, due to their high (micro)structural complexity, related to their multiphase nature, there is still a lot of unawareness behind the shielding mechanisms acting in these materials, coming as a necessity to study their microstructure-cellular/porous structure-properties relations, especially in terms of their electrical conductivity and EMI shielding efficiency (EMI SE). To target and control the electrical conductivity through a controlled distribution/dispersion of conductive nanofillers, single or combined (nanohybrids), as there is a direct relation between electrical conductivity and EMI SE, as well as the main EMI shielding mechanisms working on the developed microcellular structure of the foams, which are expected to be absorption-dominated or absorption/multiple reflection-based, are two of the main objectives when combining polymer foaming with the addition of conductive nanofillers. The present review work considers the recent developments and trends on polymer-based foams containing conductive nanofillers, especially carbon-based such as carbon nanotubes or graphene-based materials, as well as similar porous structures created using trending technologies such as 3D printing, for EMI shielding applications. It is divided in different sections, starting with the strategy of microcellular foaming to develop polymer-based foams with enhanced EMI shielding characteristics, especially focusing on technologies and methods using supercritical CO2 (sCO2); continuing with the use of polymer foams as templates to synthesize carbon foams with improved EMI shielding performance for high use temperature applications; the recent strategy of combining different functional (nano)fillers to create hybrid nanofillers/nanohybrids to be used at lower amounts as conductive fillers in polymer foams; the control and selective distribution of the nanofillers in terms of favoring the formation of a more effective conductive network and hence promote the enhancement of the EMI SE; the very recent use of computational approaches to tailor the EMI shielding properties of composite foams; and the very trending possibility of creating cellular components with varied porous structures from these materials using 3D printing; to finish, some future perspectives are discussed.

To follow the growth and development of each tree (N = 1200) Pinus sylvestris L., var. Negorelskaya starting from the seed and continuing at the juvenile (or even generative) stage is the goal of an ambitious project to create a plant passport if possible. Five datasets of replenished empirical (tab-ular and file) and systematic data reflect the early results of a unique ongoing experiment conducted with families moved along a climatic gradient from the collection area (1731 degree days, 722 mm) to the experimental area (2326 degree days; 786 mm). Datasets of morphometric, VIS-spectrometric, and germination seed data, combined with the first results of biometric data (including the Dickson quality index) of seedlings produced from these seeds, will allow scientists in the future to conduct correlation and other statistical analysis, or train a neural network to determine the presence of connections between a seed and a plant. These data contribute to the early non-destructive diag-nosis and grading of seeds according to VIS-spectrometric properties. This dataset structure can complement the FLR-Library. In the future, by tracing seedlings in their early growth (for example, over three growing seasons at the site being restored), it will be possible to determine the degree of intensification of FRM production depending on the initial properties of the seed.

The increasing volume of Municipal Solid Waste (MSW), including biodegradable plant residues such as pruning, leaves, and kitchen waste, presents a substantial environmental challenge due to the limited availability of landfill space and the resulting environmental contamination. Sustainable waste management practices, encompassing recycling and waste-to-energy conversion through biological or thermochemical processes, are imperative. In the Municipality of Athens, Greece, significant quantities of green waste generated from public and private gardening activities provide a valuable opportunity for energy recovery and landfill waste reduction. In accordance with Directive 2008/98/EC, Athens emphasizes waste prevention, reuse, recycling, and recovery. This study examines alternative bio-waste and green waste management systems, with examples from Europe, focusing on the Athens Directorate of Urban Green Spaces and Urban Wildlife. It discusses methods for assessing the energy value of pruning residues, providing a definitive disposal framework. Additionally, it presents a technoeconomic study of one of the Municipal Swimming Pools in the Municipality of Athens, investigating the production and distribution of thermal energy to meet the heating needs of the pool facilities. This research identifies key constraints and their impact on decision-making, highlighting the potential for alternative green waste management. It advocates modern recycling techniques in line with national and Community legislation, demonstrating significant environmental and economic benefits.

Background: The inflammation associated with overweight and obesity seems to alter iron metabolism, but there are few studies evaluating those conditions in children. Thus, we aimed to evaluate leukometric, immunological and hematimetric parameters of overweight and obese schoolchildren. Methods: This is a cross-sectional study, in which 39 children living in Chonim de Cima (Brazil), underwent anthropometric, hematological and immunological assessments. The evaluated parameters were compared between the study group (overweight/obesity, n=15) and the control group (n=24). Unpaired t-test, Mann-Whitney test and linear regression were used for statistical tests and the panoramic profile was used to illustrate differences between groups. Results: The study group had lower mean corpuscular volume (MCV) and mean corpuscular hemoglobin (MCH) and higher TNF levels compared to the control group. Positive correlations were observed between BMI-for-age percentile and total leukocytes (r=0.1493; p=0.0151) or neutrophils (r=0.1395; p=0.0192). Negative correlations between the BMI-for-age percentile and MCV (r=0.1464; p=0.0162) and MCH (r=0.1460; p=0.0164) were found. Furthermore, through the panoramic profile it was noted that the study group had a higher frequency of individuals with high levels of TNF and lower frequencies of individuals with increased hemoglobin and serum iron. Conclusions: Our data suggests that overweight and obesity contribute to a pro-inflammatory context (leukocytes, neutrophils and TNF) and MCV and MCH reduction in schoolchildren.