The Greenland ice sheet is a major contributor to sea level rise, adding an estimated 0.47 +/− 0.23 mm/yr to global mean sea level between 1991 and 2015 (van den Broeke et al., 2016). Making sea level rise projections for the future and understanding the processes controlling current observed rates of sea level rise are crucially dependent on understanding the present-day state of the ice sheet. Here, we provide an overview of the current state of the mass budget of Greenland based on satellite gravimetry and remote sensing observations of surface elevation change, ice sheet velocity and calving front positions. We also combine these essential climate variables with a regional climate model (RCM) output from an ice sheet model (ISM) to gain insight into poorly understood ice sheet dynamical and surface mass processes. On average from 1992 to 2017 the ice sheet in some locations has lost up −2.65 m/yr in elevation based on ESA Radar altimetry analysis. Calving fronts have retreated all around Greenland since the 1990s and in only two out of 28 study locations have they remained stable. The locations of grounding lines at 5 key glaciers with floating ice tongues have remained stable over the observation period. However a detailed case study at Petermann glacier with an ice fracture model shows the sensitivity of these floating ice shelves to future climate change. GRACE gravimetric mass balance (GMB) data allows us to tie together disparate lines of evidence showing that Greenland has lost about 265 +/− 25 Gt/yr of ice over the period 2002 to 2015. RCM and ISM simulations show that surface mass processes dominate the overall Greenland ice sheet mass budget except for areas of fast ice sheet flow but marked differences between models and between models and observations indicate that not all processes are captured accurately, indicating areas of greater uncertainty and directions of future research for future sea level rise projections.

Objective: Lipids are secreted into milk as bilayer-coated structures: milk lipid globules (MLGs). Adipophilin (ADRP) and perilipin 3 (TIP47) are associated with MLGs in human breast milk; however, the role of these proteins in milk lipid secretion is not fully understood. The aim of the study was to investigate levels of ADRP, TIP47 and total lipid content in human breast milk, their mutual correlations and dynamics during lactation. Research Methods & Procedures: Milk samples from 22 healthy lactating women (Caucasian, Central European) were collected at five time points during lactation (1–3, 12–14, 29–30, 88–90 and 178–180 days postpartum). Mass spectrometry-based method was used for quantification of ADRP and TIP47 in the samples. The gravimetric method was used to determine milk total lipid content. Results: We observed distinctive trends in ADRP, TIP47 levels and lipid content in human breast milk during the first 6 months of lactation. We also found a significant association between lipid content and ADRP, lipid content and TIP47, and ADRP and TIP47 concentrations in breast milk at all sampling points. Moreover, we derived an equation for estimating the mean lipid content of milk based on ADRP concentration in human breast milk. Conclusions: A mass spectrometry-based method was developed for quantifying ADRP and TIP47 in human breast milk. Strong mutual correlations were found between ADRP, TIP47 and total lipid content in human breast milk.

1) Background: Recently, illegal abuse of γ-hydroxybutyric acid (GHB) has increased in drug-facilitated crimes, but determination of GHB exposure and intoxication is difficult due to rapid metabolism of GHB. Its biochemical mechanism has not been completely investigated. And metabolomic study by polyamine profile and pattern analyses was not performed in rat urinefollowing intraperitoneal injection with GHB. 2) Methods: Polyamine profiling analysis by gas chromatography-mass spectrometry combined with star pattern recognition analysis was performed in this study. Multivariate statistical analysis was used to evaluate discrimination between control and GHB administration groups. 3) Results: Six polyamines were determined in control, single and multiple GHB administration groups. Star pattern showed distorted hexagonal shapes with characteristic and readily distinguishable patterns for each group. N¹-Acetylspermine (p < 0.001), putrescine (p <0.006), N¹-acetylspermidine (p <0.009), and spermine (p < 0.027) were significantly increased in single administration group but were significantly lower in the multiple administration group than in the control group. N¹-Acetylspermine was the main polyamine for discrimination between control, single and multiple administration groups. Spermine showed similar levels in single and multiple administration groups. 4) Conclusions: The polyamine metabolic pattern was monitored in GHB administration groups. N¹-Acetylspermine and spermine were evaluated as potential biomarkers of GHB exposure and addiction.

In this paper we present the measurement of charged pion two-particle femtoscopic correlation functions in $\sqrt{S_{NN}}$= 200 GeV Au+Au collisions, in 31 average transverse mass bins, separately for positive and negative pion pairs. Lévy-shaped source distributions yield a statistically acceptable description of the measured correlation functions, with three physical parameters: correlation strength parameter λ , Lévy index α and Lévy scale parameter R. The transverse mass dependence of these Lévy parameters is then investigated. Their physical interpretation is also discussed, and the appearance of a new scaling variable is observed.

In the face of the burgeoning electricity demands and the imperative for sustainable development amidst rapid industrialization, this study introduces a dynamic and adaptable framework suitable for policy-makers and renewable energy experts working on integrating and optimizing renewable energy solutions. While using a case study representative model for Sub-Saharan Africa (SSA) to demonstrate the challenges and opportunities present in introducing optimization methods to bridge power supply deficits and the scalability of the model to other regions, this study presents an agile multi-criteria decision tool that pivots on four key development phases, advancing upon established methodologies and pioneering refined computational techniques, to select optimal configurations from a set of Policy Decision Making Metrics (PDM-DPS). Central to this investigation lies a rigorous comparative analysis of variants of three advanced algorithmic approaches: Swarm-Based Multi-objective Particle Swarm Optimization (MOPSO), Decomposition-Based Multi-objective Evolutionary Algorithm (MOEA/D), and Evolutionary-Based Strength Pareto Evolutionary Algorithm (SPEA2). These are applied to a grid-connected hybrid system, evaluated through a comprehensive 8760-hour simulation over a 20-year planning horizon. The evaluation is further enhanced by a set of refined Algorithm Performance Evaluation Metrics (AL-PEM) tailored to the specific constraints. The findings not only underscore the robustness and consistency of the SPEA2 variant over 15 runs of 200 generations each, which ranks first on the AL-PEM scale but also validate the strategic merit of combining multiple technologies and empowering policymakers with a versatile toolkit for informed decision-making.

With the rising awareness of environmental issues, concerns about pollution and global warming have gained importance, and electricity generation costs continue to increase. As a result, research on energy recovery using thermoelectric modules has attracted attention in recent years. Given the lack of significant breakthroughs in thermoelectric materials, improving the structure of thermoelectric modules has become a key direction for enhancing efficiency. Common thermoelectric module types include flat plate (Flat Plate TEG), annular (Annular TEG), flexible (Flexibility TEG), segmented, and cascaded designs. Factors influencing thermoelectric performance include the number, shape, height, contact area of thermoelectric elements, temperature difference, copper plate length, contact resistance, and the geometric arrangement of the elements. This study is based on the commercially available TGM1-127-1.0-0.8 thermoelectric module. By simulating the output performance of both flat plate and annular thermoelectric module structures under identical conditions—such as total volume of thermoelectric material, shape, and height of the thermoelectric legs, the total contact area with the heat source, temperature differential, and total volume of the connecting copper plate—we observed that the number of thermoelectric elements not only determines the open-circuit voltage but also influences the output power. The trend of output power remains consistent under varying temperature differences, regardless of changes in the load resistance.

Recent progress in studies of Rydberg double-well electronic energy states of MeNg (Me=12-group atom, Ng=noble gas atom) van der Waals (vdW) molecules is presented and analysed. The presentation covers approaches in experimental studies as well as ab-initio-calculations of potential energy curves (PEC). The analysis is shown in a broader context of Rydberg states of hetero- and homo-diatomic molecules with PECs possessing complex ‘exotic’ structure. Laser induced fluorescence (LIF) excitation spectra and dispersed emission spectra employed in spectroscopical characterization of Rydberg states are presented on the background of diversity of spectroscopic methods of their investigations such as laser vaporization-optical resonance (LV-OR), pump-and-probe methods and polarization labelling spectroscopy. Importance and current state-of-the-art applications of Rydberg states with irregular potentials in photoassociation (PA), vibrational and rotational cooling, molecular clocks, frequency standards and molecular wave-packet interferometry is highlighted.

This study focuses on the design, installation, and performance evaluation of a photovoltaic farm situated in Tulcea County, Romania, connected to a 20 kV distribution network. The farm, with a peak capacity of approximately 2800 kWp, benefits from Romania’s favorable climate conditions and supportive renewable energy policies. The analysis encompasses both the photovoltaic panel array and the electrical energy evacuation system. The substation at the park is equipped with technology that adheres to European standards and incorporates advanced features typical of modern electricity distribution networks. The assessment includes an evaluation of the park’s operational efficiency, with detailed calculations of the performance ratio and various power losses attributed to factors like temperature fluctuations, fouling, inverter efficiency, grid-related challenges, and availability issues. The farm contributes around 3620 MWh of electricity to the grid annually, demonstrating the effectiveness of photovoltaic installations in promoting sustainable energy solutions within regional energy networks.

Motivated by South Africa's need in the transition to a net-zero economy; this study 10 investigates the integration of renewable energy sources (RES) into oil refineries, considering 11 therein unique challenges and opportunities. The research focuses on optimizing RES allocation 12 using Particle Swarm Optimization (PSO), a data-driven approach that adapts to real-time 13 operational conditions. Traditional energy management systems often struggle with the inherent 14variability of RES, leading to suboptimal energy distribution and increased emissions. Therefore, 15 this study proposes a PSO-based renewable energy allocation strategy specifically designed for oil 16 refineries. It considers factors like the levelized cost of energy, geographical location, and available 17 technology. The methodology involves formulating the optimization problem, developing a PSO 18 model, and implementing it in a simulated oil refinery environment. The results demonstrate 19 significant convergence of the PSO algorithm, leading to an optimal configuration for integrating 20 RES and achieving cost reductions and sustainability goals. The optimization result of 4,457,527.00 21 Rand achieved by iterations is much better than the result of 4,829,638.88 Rand acquired using 22Linear Programming as the baseline model. The mean cost, indicating consistent performance, has 23 remained at its original value of 4,457,527.00 Rand, highlighting the convergence. Key findings 24 include the average distance measure decreasing from 4.2 to 3.4, indicating particle convergence; 25 swarm diameter decreasing from 4.7 to 3.8, showing swarm concentration on promising solutions; 26 average velocity decreasing from 7.8 to 4.25, demonstrating refined particle movement; and the 27 optimum cost function achieved at 4,457,527 Rand with zero standard deviation, highlighting 28 stability and optimal solution identification. This research offers a valuable solution for oil 29 refineries seeking to integrate RES effectively, contributing to South Africa's transition to a 30sustainable energy future.

Building a new-type power system is the key core of the green and low-carbon development of energy, the restructuring of the power system will inevitably have a linked impact on the coordinated development of the economy-energy-environment (3E) system. This paper constructs a "Dual-Triangle" theoretical framework consisting of the “Energy Trilemma” and the "Sustainable Development Triangle", by combining historical statistical analysis with scenario predictive analysis, analyzes the historical characteristics of the "Dual Triangle" and future development trends under different scenarios, and studies the coupled interaction relationship of the "Dual-Triangle" to explore the optimal transformation path of the power system that is most beneficial to the coordinated development of the 3E system. The conclusions are as follows: (1) The energy system gradually inclined towards economy and cleanliness from 2010 to 2022, the level of coordinated development of the 3E system fluctuated upwards, and the operation status of the "Dual Triangle" was stable. (2) Positive coupling relationship between "Dual Triangle" of scenario S1 is close, which can be regarded as the preferred path for the reconstruction of the power system. Due to phased development has clear development priorities, scenario S2 will artificially break the balance of the “Energy Trilemma”, which is a development model that dynamically mitigates the challenges of the “Energy Trilemma”.(3)The contradiction between economy and cleanliness is continuously weakened, and security has become the core contradiction of the "Impossible Triangle". The combination of renewable energy and energy storage is the key to resolving this contradiction. This paper conducts an integrated and innovative application of the "Dual-Triangle" theory, and the results provide a case basis for how to achieve the coupled interaction of the "Dual-Triangle", promote high-quality energy development, and support the sustainable development of the economy and society.

India, the world’s most populous country, is the world's third-largest emitter of greenhouse gases (GHGs). Despite employing several energy sources, it still relies heavily on coal, its primary energy source. Given India’s swiftly rising energy demand, this challenges meeting emission reduction targets. India has significantly increased investments in renewables like solar and hydrogen in recent years. While commendable, these initiatives alone cannot meet the country's expanding energy demands. In the short term, India must rely on both domestic and imported fossil fuels, with natural gas being the most environmentally friendly option. In this context, this paper attempts to forecast energy consumption, natural gas production, and consumption in India till 2050 using both univariate and multivariate forecasting methods. For multivariate forecasting, we have assumed two alternative possibilities for GDP growth: the business-as-usual and the high-growth scenarios. Each of our forecasts indicates a notable shortfall in the projected production of natural gas compared to the expected demand, implying our results are robust. Our model predicts that nearly 30-50 percent of India’s natural gas consumption will be met by imports, mainly in the form of LNG. Based on these findings, this paper recommends that Indian government policies emphasize increasing domestic natural gas production, importing LNG, and expanding renewable energy resources.

The average sizes \ {\bar{L}}_{i\ } and their dispersion W_i along the i-th axis of crystallites in powders are used to determine the X-ray diffraction sizes, D_{i\ XRD}, averaged over crystallite columns within the BWA method. Numerical calculations have been carried out for an orthorhombic lattice of crystallites, such as LiFePO4, NMC, having Lamé's g-type superellipsoid shape. For Lognormal distributions, the analytical expression for the normalized coefficient Kn is found and includes two constants. The first K_{g,0} is a constant at W→0, the second K_g is a constant depending on the g -type shape. The dependences of D_{i\ XRD} are also calculated for Normal distribution. A fairly simple equation can be obtained as a result of analytical transformations in the framework of experimentally validated approximations. However, a simpler way is to carry out numerical computer calculations with subsequent approximation of the calculated curves. Using the obtained analytical expressions to control technologies from nuclear fuel to cathode materials will improve the efficiency of flexible energy network especially storage in autonomous and standby power plants.

Recent years have seen a rapid uptake in distributed energy resources (DER). Such technologies pose a number of challenges to network operators, which can ultimately limit the amount of rooftop solar photovoltaics (PV) systems that can be connected to a network. The objective of this industry-based research was to determine the potential network effects of forecast levels of customer owned rooftop solar PV on Energy Queensland’s distribution network and formulate functions that can be used to determine such effects without the requirement for detailed network modeling and analysis. In this research, many of Energy Queensland’s distribution feeders were modelled using DIgSILENT PowerFactory and analyzed with forecast levels of solar PV and customer load. Python scripts were used to automate this process and quasi dynamic simulation (QDSL) models were used to represent the dynamic volt-watt and volt-var response of inverters, as mandated by the Australian Standard AS/NZS 4777. In analyzing the results, linear regression was used to form trend equations that represent various network characteristics against the number of PV connections. The trend equations provide a way of approximating network characteristics for other feeders under various levels of customer owned rooftop solar PV without the need for detail modeling.

Abstract: The internationally accepted goals of eliminating climate gas emissions implies substantial investments in renewable energy (RE) facilities. This will inevitably lead to major impacts on landscapes. Landscape concerns linked to RE facilities are already leading to controversies in many local communities. In this article, we focus on the question of landscape democracy related to the establishment of RE facilities. Based on recommendations from the European Landscape Convention, an analytical framework is presented identifying three main dimensions of landscape democracy, followed by an overview of arrangements, procedures and methods that are or may be used to encourage democracy. The procedures and methods are analysed based on examples from Denmark and Norway. This is followed by an analysis of decision levels with a special focus on the principle of subsidiarity. Finally, recommendations are presented to strengthen landscape democracy in relation to the installation of RE-facilities.

Up to now, Schrödinger equation, Klein-Gordon equation (KGE) and Dirac equation are believed the fundamental equations of quantum mechanics. Schrödinger equation has a defect that there is no NKE solutions. Dirac equation has positive kinetic energy (PKE) and negative kinetic energy (NKE) branches. Both branches should have low momentum, or nonrelativistic, approximations: one is Schrödinger equation and the other is NKE Schrödinger equation. KGE has two problems: it is an equation of second time derivative, and calculated density is not definitely positive. To overcome the problems, it should be revised as PKE and NKE decoupled KGEs. The fundamental equations of quantum mechanics after the modification have at least two merits. They are of unitary in that everyone contains the first time derivative and are symmetric with respect to PKE and NKE. This reflects the symmetry of the PKE and NKE matters, as well as matter and dark matter, of our universe. The problems of one-dimensional step potentials are resolved by means of the modified fundamental equations for a nonrelativistic particle.

The mechanisms of natural oscillations and resonance are described, considering the peculiarities of the transformation of elastic and kinetic energy in the implementation of the law of conservation of energy in local and integral volumes of the body, using the concept of mechanics based on the concepts of space, time and energy. When describing the motion in the Lagrange form, the elastic deformation energy of the particles is determined by the quadratic invariant of the tensor, whose components are the partial derivatives of Euler variables with respect to Lagrange variables. The increment of the invariant due to elastic deformation is represented as the sum of two scalars, one of which depends on the average value of the relative lengths of the edges of the particles in the form of an infinitesimal parallelepiped, the second is equal to the standard deviation of these lengths from the average value. It is shown that each of the scalars can be represented in the form of two dimensionless kinematic parameters of elastic energy, which participate in different ways in the implementation of the law of conservation of energy. One part of the elastic energy passes into kinetic energy and participates in the implementation of the law of conservation of energy for the body as a whole, considering external forces. The second part is not converted into kinetic energy but changes the deformed state of the particles in accordance with the equations of motion while maintaining the same level of the part of the elastic energy of the particles used for this. The kinematic parameters differ from the volume density of the corresponding types of energy by a factor equal to the elastic modulus, which is directly proportional to the density and heat capacity of the material and inversely proportional to the volume compression coefficient. Transverse, torsional, and longitudinal vibrations are considered free and under resonance conditions. The mechanisms of transformation of forced vibrations into their own after the termination of external influences and resonance at the superposition of free and forced vibrations with the same or similar frequency are considered. The formation of a new free wave at each cycle with an increase in the amplitude, which occurs mainly due to internal energy sources, and not external forces, is justified.

We present a model of space that considers it to be a quantized dynamical entity which is a component of the universe along with matter and radiation. The theory is used together with thermodynamic data to provide a new view of cosmic evolution and an insight into the nature of dark energy and dark matter. Space is made up of energy quanta. The universe started from an atomic size volume at very high temperature and pressure near the Planck epoch. Upon expansion and cooling, phase transitions occurred resulting in the formation of radiation, fundamental particles, and matter. These nucleate and grow into stars, galaxies, and clusters. From a phase diagram of cosmic composition, we obtained a correlation between dark energy and the energy of space. Using the Friedmann equations, data from WMAP studies of the composition of the universe at 3.0 x 10⁵ (a=5.25 x 10^-2) years and at present (a=1), are well fitted by our model with an equation of state parameter, w= -0.7. The accelerated expansion of the universe, starting at about 7 billion years, determined by BOSS measurements, also correlates well with the dominance of dark energy at 7.25 x 10⁹ years ( a= 0.65). The expansion can be attributed to Quintessence with a space force arising from a quantum space field. From our phase diagram, we also find a correlation suggesting that dark matter is a plasma form of matter similar to that which existed during the photon epoch immediately prior to recombination. Our Quantum Space Model leads to a universe which is homogeneous and isotropic without the need for inflation. The thermodynamics of expansion is consistent with BOSS data that show the process to be adiabatic and the rate of expansion decelerating during the first 6 billion years after the Big Bang. However, it became non-adiabatic and accelerating thereafter. This implies an influx of energy from a source outside the universe; it warrants consideration as a possible factor in the accelerated expansion of the universe.

DC residential distribution system (RDS) consisted by DC living home will be a significant integral part in the future green transmission. Meanwhile, the increasing number of distributed resources and intelligent devices will change the power flow between main grid and demand sides. The utilization of distributed generations (DGs) requires an economic operation, stability, environmentally friendly in the whole DC system. This paper not only presents an optimization schedule and transactive energy (TE) approach through centralized energy management system (CEMS), but a control approach to implement and ensure DG output voltages to various DC buses in DC RDS. Based on data collection, prediction and a certain objection, the expert system in CEMS can work out the optimization schedule, after this, the voltage droop control for steady voltage is aligned with the command of unit power schedule. In this work, a DC RDS is as a case study to demonstrate the process, the RDS is associated with unit economic models, cost minimization objective is proposed to achieve based on real-time electrical price. The results show that the proposed framework and methods will help the targeted DC residential system to reduce the total cost and reach stability and efficiency.

This study advances the field of solar irradiance nowcasting by introducing a discrete-level classification approach, diverging from traditional continuous measurement methods. Grounded in a need for cost-effective and modular solutions, the research employs high-resolution computer vision coupled with a deep learning framework to predict Direct Normal Irradiance (DNI). By harnessing the capabilities of a Logitech C900 1080p HD camera and an NVIDIA Jetson module, the study achieves real-time data processing, pivotal for CSP systems' operational efficiency. The core of the methodology is the ResNet-50 convolutional neural network, refined via transfer learning on a bespoke dataset, culminating in a predictive accuracy of 85.78%. This discrete classification model contrasts with conventional, costly instruments like the MS-57, offering a novel and accessible alternative for DNI estimation. Such innovation not only demonstrates high predictive accuracy but also signifies a shift towards less resource-intensive and more adaptable solar energy forecasting tools, contributing a significant leap towards optimizing renewable energy systems.

This paper delves into the intricate nature of the different essence interactions that shape our perceived reality, leveraging a blend of existing empirical data and original experiments. Through a multidisciplinary approach encompassing quantum mechanics, general physics, metaphysics, philosophy, and spiritualism, it seeks to elucidate the fundamental interplays governing phenomena such as gravity, mass, electromagnetism, force, motion, and quantum mechanics. This exploration promises a reexamination and unification of these principles, offering novel perspectives on the extraordinary phenomena that underpin our reality. By comprehending and manipulating these interactions, the potential arises to orchestrate reality towards desired ends. This study not only unveils compelling avenues for scientific advancement but also proposes transformative technologies and concepts, including light-speed transportation, remote viewing, communication with the deceased, alchemy, and the realization of what is commonly perceived as magic. These visionary notions not only push the boundaries of current understanding but also provide a captivating glimpse into the future possibilities that may await humanity.

The aim of the present work is to explore a different non-traditional approach to higher dimensional spacetime which differs from the usual approaches such as large extra space dimensions, warped extra space dimensions and multiple extra time dimensions. This approach will be referred to as "Dynamic" higher dimensional spacetime. By this term will be introduced a new kind of higher dimensional spacetime (more than the usual 3+1 dimensions), which behaves dynamically in the sense that time is not a fixed dimension but is the extra plus one dimension to the spatial dimensions of the phenomenon we are studying. For a higher dimensional phenomenon, the lower dimensional time will behave as space and the new time will be a plus one dimension, meaning if we study a 3-dimensional phenomenon then time is the usual 4th dimension but if we are studying a 4-dimensional phenomenon then its time will be an extra 5th dimension and for this phenomenon the 4th dimension will behave as space. All spatial dimensions are indistinguishable from each other and behave in the exact same way, which means that the important parameter is not the dimension we are studying (for example the 4th or the 5th) but the number of dimensions in which a phenomenon can interact and how higher dimensional phenomena interact with lower ones. This non-traditional approach to higher dimensional spacetime may appear confusing at first but will become clearer in the rest of the paper. For this reason, we will first associate the time dimension with propagation relative to space dimensions and change orthogonal to them in order to give the reader a better intuition. Following that, we will describe how higher - dimensional phenomena would appear to us, the 3 - dimensional observer and try to set some guidelines on how we should mathematically model higher - dimensional phenomena in order for us to make accurate predictions of their behaviour. Then we will express the general framework of a "Dynamic" higher - dimensional spacetime and turn our gaze to 4+1 – dimensional phenomena. We will explore how a mass term arises for 4 – dimensional waves by generalizing the frequency – speed – wavelength relation of 3D waves and give a basic description on a possible way to describe a 4+1 – dimensional disturbance in a scalar Energy Field in order to make accurate predictions on our 3+1 dimensional plane. In this framework we will derive the Klein – Gordon equation by generalizing the wave equation and ignoring all lower than 4+1 - dimensional disturbances and compere our mass term findings with the Klein – Gordon equation mass term and with results from gravity – induced quantum interference experiments. Lastly, we will describe how a "Dynamic" 5 - dimensional spacetime would appear in a 3D observer and examine whether our findings are compatible with quantum mechanics and the special theory of relativity.

The surface thermodynamic properties of polymers and copolymers modified by supramolecular structures are very used in several industrial processes, such as selective adsorption, paints, coatings, colloids, and adhesion applications. Background: Inverse gas chromatography at infinite dilution was proved to be the best technique to determine the surface properties of solid surfaces by studying the adsorption of some model polar and non-polar organic molecules adsorbed on solid surfaces by varying the temperature. Methods: The retention volume of adsorbed solvents is a precious parameter to obtain the London dispersive and polar free energies and the London dispersive surface energy of styrene–divinylbenzene copolymer modified by supramolecular structure of melamine using the Hamieh thermal model and our new methodology consisting in the separation of the two polar and dispersive free energy of interaction. This led to the determination of the polar acid and base surface energy, and the Lewis’s acid-base constants of the various solid materials. Results: all surface energetic properties of styrene–divinylbenzene copolymer modified by melamine at different percentages were determined as a function of temperature, following our new methodology. Conclusions: It was observed that the styrene–divinylbenzene copolymer exhibited the highest London dispersive surface energy which decreased when the melamine percentage increased. All materials presented higher Lewis’s basicity and this Lewis’s basicity increased with the percentage of melamine.

Alzheimer's disease (AD) is a neurodegenerative disease characterized by memory loss and progressive deterioration of cognitive functions. Being able to identify reliable biomarkers in easily available body fluids such as blood plasma is vital for the disease. To achieve this, we used a technique that applied human plasma to organotypic brain slice culture via microcontact print-ing. After a 2-week culture period, we performed immunolabeling for neurofilament and myelin oligodendrocyte glycoprotein (MOG) to visualize newly formed nerve fibers and oligodendro-cytes. There was no significant change in the number of new nerve fibers in the AD plasma group compared to the healthy control group, while the length of the produced fibers significantly de-creased. A significant increase in the number of MOG+ dots around these new fibers was detected in the patient group. According to our hypothesis, there are factors in the plasma of AD patients that affect the growth of new nerve fibers, which also affect the oligodendrocytes. Based on these findings, we selected the most promising plasma samples and conducted mass spectrometry us-ing a differential approach and we identified 3 putative biomarkers: aldehyde-dehydrogenase 1A1, alpha-synuclein and protein S100-A4. Our method represents a novel and innovative ap-proach to translate research findings from mouse models to human applications.

Background: The Advanced Lung Cancer Inflammation Index (ALI) is a novel, comprehensive index that integrates inflammation and nutritional status, incorporating parameters such as albumin, body mass index (BMI), and the neutrophil-to-lymphocyte ratio (NLR). Unlike traditional inflammation biomarkers, this study aims to evaluate the prognosis of IPF patients by considering both inflammation and nutritional status. Method: A total of 102 patients with IPF were included in the study. Clinical data were obtained from the patients’ medical records. NLR and ALI score were calculated based on data collected at the initiation of antifibrotic treatment using the following formula: Neut/Lym and albumin × BMI / NLR. Results: IPF subject subgroups in terms of ALI based on gender–age–physiology (GAP) stages (1,2,3), FVC (median split, <70% vs ≥70%), DLCO (<51% vs ≥51%), 6-Minute Walk Test (6MWT) (<350 vs ≥350) and CCI (≤1 vs >1). ALI showed significant difference depending on the categories of GAP stage, FVC, DLCO, and 6MWT but these differences were not observed based on the charlson comorbidity index (CCI) categories (sırasıyla p=0.000, p=0.000, p=0.000, p=0.001, p=0.233). Receiver Operating Characteristic (ROC) curve analysis was performed to evaluate the sensitivity and specificity of ALI, albumin, NLR, and BMI in determining the mortality risk in IPF patients. ALI demonstrated a sensitivity of 63.6% and a specificity of 98.9% at a threshold of 11.2 (AUC = 0.945, 95% CI 0.892–0.998, p < 0.000). Conclusion: We determined that ALI levels are significantly associated with disease severity and mortality in patients with IPF.

Nitraria tangutorum Bobrov is a berry shrub with white flowers and red fruits, which grows in the deserts in the Tibetan Plateau, Mongolia, and western China. Its fruit N. tangutorum fruit (NTF) contains various bioactive compounds, with anti-fatigue, anti-inflammatory, and neuroprotective functions. However, the high saccharide content of NTF makes it unsuitable for diabetic patients. In this study, we fermented NTF to obtain N. tangutorum fermented juice (NTJ), and N. tangutorum fermented residue (NTR), which are suitable for diabetics to consume. We characterized the bioactive compounds in NTF, NTR, and NTJ, and found that fermentation increased the diversity of bioactive compounds, and greatly reduced sucrose, glucose, and fructose content while generating trehalose, which has the potential to manage blood glucose levels. Further, NTJ displays anti-diabetic potential due to various compounds anti-diabetic properties. This study provides a basis for further clinical research on NTJ's anti-diabetic function in humans.

Since the photocatalytic reaction is a surface reaction, enhancing the gas movement around photocatalyst would promote photocatalytic CO₂ reduction performance. A new approach to enhance the gas movement around the photocatalyst by the natural thermosiphon movement of gasses around photocatalyst using black body material was proposed and confirmed experimentally, but the heat transfer mechanism on the phenomena was not clarified yet. The purpose of this study is to clarify the heat transfer mechanism of it. This study calculated the temperature of mixed gases of CO₂ and NH₃ around P₄O₁₀/TiO₂ photocatalyst by the heat transfer formula. It is revealed that there was no difference between the increase temperature (T_g) from the temperature at the beginning of the CO₂ reduction experiment (T_ini) and the temperature of mixed gases of CO₂ and NH₃ measured by thermocouple in the experiment (T_e) under the illumination condition with a visible light (VIS) + an infrared light (IR) and IR only. The heat transfer model proposed by this study has predicted T_g well under the illumination condition with VIS + IR and IR only well. On the other hand, it is revealed that the difference between T_g and T_e was as large as 10 ℃ under the illumination condition with an ultra violet light (UV) + VIS + IR.

A recent research has identified an inverse amplitude link between obliquity damping and short eccentricity amplification during Mid-Late Pleistocene based on LR04 δ18O and equatorial Pacific Site 846 sea surface temperature records, which is associated with the Earth's long-term cooling. In the present study, new evidence of this anticorrelation is presented from Antarctic D-CO2-CH4 records, global benthic-planktic δ18O, and regional (Atlantic, Pacific, Mediterranean, and Indian) climate-related proxies. Based on a critical review of theoretical constrains (Earth's oblateness changes and ice-volume phase lag in the obliquity band <5.0 kyr), this widespread and symmetric (bipolar) obliquity response damping has been interpreted as an effect of the obliquity-oblateness feedback, which could be the latent physical mechanism at the origin of the Mid-Pleistocene Transition (MPT). Indeed, results and considerations of the present work suggest that fast and positive/negative net variation of the Earth's oblateness in the obliquity band was controlled by dominant glacio-eustatic water mass component and, assuming a rapid response of the ice-volume to surface temperature changes, the mean obliquity lag response is estimated to be <5.0 kyr over the past 800 kyr. These elements may explain the interglacial/glacial damping observed in the obliquity response. The consolidation of the Earth's long-term icy-state in the subtrend IV, culminated with the post-MPT obliquity damping, might have contributed to the strengthening of the short eccentricity response by mitigating the obliquity ‘ice-killing’ during obliquity maxima (interglacials), favouring the obliquity-cycle skipping and a feedback amplified ice-growth in the short eccentricity band (obliquity damping hypothesis). This could suggest a different impact of the climate friction than what is generally believed, which is presumably the latent physical mechanism that triggers transient ‘competitive’ interaction between obliquity and short eccentricity started early during the Piacenzian.

Abstract Tetraspanin CD63 is a cluster of cell surface proteins with four transmembrane domains which associates with tetraspanin-enriched microdomains and typically localizes to late endosomes and lysosomes. CD63 plays an important role in cellular trafficking of different proteins, EV cargo sorting and vesicles formation. We have preciously shown that CD63 is important in LMP1 trafficking to EVs and this also affects LMP1 mediated intracellular signaling including MAPK/ERK, NF-κB and mTOR activation. Using the BioID combined with mass spectrometry, we sought to define the broad CD63 interactome and how LMP1 modulates this network of interacting proteins. We identified a total of 1600 total proteins as proximal interacting newtwork of proteins to CD63. Biological process enrichment analysis revealed significant involvement in signal transduction, cell communication, protein metabolism and transportation. The CD63 only interactome was enriched in Rab GTPases, SNARE proteins and sorting nexins while adding LMP1 into the interactome increased presence of signaling and ribosomal proteins. Our results showed that LMP1 alters the CD63 interactome, shifting the network of proteins enrichment from protein localization and vesicle mediated transportation to metabolic processes and translation. We also show that LMP1 interacts with mTor, Nedd4L and PP2A indicating formation of a multiprotein complex with CD63 thereby potentially regulating LMP1 dependent mTor signaling. Collectively, the comprehensive analysis of CD63 proximal interacting proteins provides insights into network of partners required for endocytic trafficking, extracellular vesicle cargo sorting, formation and secretion.

We aimed to explore university students’ perceptions and experiences of SARS-CoV-2 mass asymptomatic testing, social distancing and self-isolation during the COVID-19 pandemic. This qualitative study comprised of four rapid online focus groups conducted at a higher education institution in England during high alert (tier 2) national COVID-19 restrictions. Data were analysed thematically. Participants were purposively sampled university students (n = 25) representing a range of gender, age, living circumstances (on/off campus) and SARS-CoV-2 testing/self-isolation experiences. Six themes with 16 sub-themes emerged from the analysis of the qualitative data: ‘Term-time Experiences’, ‘Risk Perception and Worry’, ‘Engagement in Protective Behaviours’, ‘Openness to Testing’, ‘Barriers to Testing’ and ‘General Wellbeing’. Students described feeling safe on campus, believed most of their peers are adherent to protective behaviours and were positive towards asymptomatic testing in university settings. University communications about COVID-19 testing and social behaviours need to be timely and presented in a more inclusive way to reach groups of students who currently feel marginalised. Barriers to engagement with SARS-CoV-2 testing, social distancing and self-isolation were primarily associated with fear of the mental health impacts of self-isolation, including worry about how they will cope, high anxiety, low mood, guilt relating to impact on others and loneliness. Loneliness in students could be mitigated through increased intra-university communications and a focus on establishment of low COVID-risk social activities to help students build and enhance their social support networks. These findings are particularly pertinent in the context of mass asymptomatic testing programmes being implemented in educational settings and high numbers of students being required to self-isolate. Universities need to determine the support needs of students during self-isolation and prepare for the long-term impacts of the pandemic on student mental health and welfare support services.

NASA mission systems proposals are often compared using an equivalent system mass (ESM) framework wherein all elements of technology to deliver an effect- its components, operations and logistics of delivery- are converted to effective masses since this has a known cost scale in space operations. To date, ESM methods and the tools for system comparison have not considered complexities wherein systems that serve a mission span multiple transit and operations stages, such as would be required to support a crewed mission to Mars, and thus do not account for the different mass equivalency factors operational during each period and the inter-dependencies of the costs across the mission. Further, ESM does not account well for the differential reliabilities of the underlying technologies. Less reliability should incur an equivalent mass cost for technologies that might otherwise provide a mass advantage. We introduce an extensions to ESM to address these limitations and show that it provides a direct method for analyzing, optimizing and comparing different mission systems. We demonstrate our extended ESM (xESM) calculation with crop production technologies -- an aspect of the developing offworld biomanufacturing suite -- since it represents a case with strong coupling among stages of the mission and a relatively high-risk profile.

Fractional-time Schrödinger equation (FTSE) describes the evolution of quantum processes endowed with memory effects. FTSE manifestly breaks all consistency requirements of quantum field theory (unitarity, locality and compliance with the clustering theorem), unless the order of fractional differentiation and integration ( ) falls close to the standard index . Working in the context of the minimal fractal manifold (where , ), we confirm here that FTSE approximates the attributes of gravitational metric and provides an unforeseen generation mechanism for massive fields.

Man-made shallow fishponds in the Czech Republic have been facing a high eutrophication since 1950s. Anthropogenic eutrophication and feeding of fish have strongly affected the physico-chemical properties of water and its aquatic community composition leading to harmful algal bloom formation. In our current study, we have characterised the phytoplankton community across three hypertrophic ponds to assess the phytoplankton dynamics during the vegetation season. We microscopically identified and quantified 29 cyanobacterial taxa comprised of non-toxigenic and toxigenic species. Further, a detailed cyanopeptides (CNPs) profiling was performed using molecular networking analysis of liquid chromatography tandem mass spectrometry (LC–MS/MS) data coupled with dereplication strategy. This MS networking approach coupled with dereplication on online global natural product social networking (GNPS) web platform led us to putatively identify forty CNPs: fourteen anabaenopeptins, ten microcystins, five cyanopeptolins, six microginins, two cyanobactins, a dipeptide radiosumin, a cyclooctapeptide planktocyclin and epidolastatin12. We have applied the binary logistic regression to estimate the CNPs producer by correlating the GNPS data with the species abundance. Usage of The combination of molecular networking and dereplication on online global natural product social networking (GNPS) web platform has proved as a valuable approach for rapid and simultaneous detection of high number of peptides, and rapidly assessing the risk for harmful bloom.

The simultaneous evaluation of heat/mass transference procures momentous significance in the polymer industry and engineering activities. Extensive utilization of such aspects includes propylene flares, heat exchangers, energy transfiguration in chilling towers, and amputation of post fortuitous heat in nuclear reactors. Owing to such prospective demands, we interpreted the Jeffrey liquid reactive flow under non-linear convection. We scrutinized the transference of heat/mass under generalized Fourier-Fick relations. Thermal conductivity depends on temperature while mass diffusivity is dependent on concentration. Besides, heat source along with first-order chemical reaction aspects are accounted for. Relevant transformations are exerted to achieve non-linear differential systems that are solved through the homotopy scheme. Influences of divers factors are exhibited via graphical benchmark.

Corona viruses hijack human enzymes to assembly sugar coat on Spike glycoproteins. The mechanism that human antibodies may uncover the antigenic viral peptide epitopes hidden by sugar coat are unknown. In this study, we analyzed recombinant SARS-CoV-2 Spike protein secreted from BTI-Tn-5B1-4 cells, by trypsin and chymotrypsin digestion followed by mass spectrometry analysis. We acquired MS/MS spectrums for glycopeptides of all 22 predicted N-glycosylated sites. We further analyzed the surface accessibility of Spike proteins according to Cryo-EM and homolog-modeled structures, and available antibodies that bind to SARS-CoV-1. The results showed that all 22 N-glycosylated sites of SARS-CoV-2 are modified by high-mannose type of N-glycans. MS/MS fragmentation clearly established the glycopeptide identities. Electron densities of glycans cover most of the Spike receptor binding domain of SARS-CoV-2, except YQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQ, similar to a region FSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQ in SARS-CoV-1. Other surface-exposed domains included those located on Central Helix, between amino acids 967 and 1016 of SARS-CoV-1, and 985 to 1034 of SARS-CoV-2 Spike protein. As the majority of antibody paratopes bind to peptide portion with or without sugar modification, we propose a snake-catcher model that a minimal length of peptide is first clamped by a paratope, and the binding is either strengthened by sugars close to peptide, or not interfered by sugar modification.

Improving air quality and reducing human exposure to unhealthy levels of airborne chemicals are important global missions, particularly in China. Satellite remote sensing offers a powerful tool to examine regional trends in NO2, thus providing a direct measure of key parameters that strongly affect surface air quality. To accurately resolve spatial gradients in NO2 concentration using satellite observations and thus understand local and regional aspects of air quality, a priori input data at sufficiently high spatial and temporal resolution to account for pixel-to-pixel variability in the characteristics of the land and atmosphere are required. In this paper, we adapt the Berkeley High Resolution product (BEHR v3.0A, v3.0B and v3.0C) and meteorological outputs from the Weather Research and Forecasting (WRF) model to describe column NO2 in southern China. The BEHR approach is particularly useful for places with large spatial variabilities and terrain height differences such as China. We retrieved tropospheric NO2 vertical column density (TVCD) within part of southern China, for four seasons of 2015, based upon satellite datasets from Ozone Monitoring Instrument (OMI). Retrieval results are validated by comparing with MAX-DOAS tropospheric column measurements conducted in Guangzhou. BEHR retrieval algorithms are more consistent with MAX-DOAS measurements than OMI-NASA retrieval, opening new windows into research questions that require high spatial resolution, for example retrieving NO2 vertical column and ground pollutant concentration in China and other countries.

This paper introduces an approach that chooses the fault detection by calculating probabilities using probability mass function (pmf) and cumulative distribution function (CDF). This work used a method for multiple stuck-at faults by producing a new test pattern in combinational circuits. We assumed that existence of all multiple faults is only because of one single component that is faulty. A complete test set can be created by all possible single stuck-at faults in a combinational circuit using some combination of gates. The test set generation fault detection method is applied on two different 3-bit input variable and 4-bit input variable circuits. The probability of error occurrence is calculated at both 3-bit and 4-bit input variable circuits. The resulting feature is used to obtain maximum error occurrence probability to detect faults by the logic used that the complexity of the circuit is inversely proportional to the fault occurrence probability. Then again, undetectability is directly proportional to the complexity of the circuit. Therefore, finest feasible circuit should have large input variable components with less complexity to reduce the fault occurrence probability.

Almond is worldwide consumed and renowned as a valuable healthy food. In spite of this, it is also a potent source of allergenic proteins able to trigger several mild to life-threatening immunoreactions. Food processing proved to alter biochemical characteristics of proteins, thus affecting the respective allergenicity. In this paper we investigated the effect of autoclaving, preceded or not by a hydration step, on the biochemical and immunological properties of almond proteins. Any variation in the stability and immunoreactivity of almond proteins extracted from the treated materials, were evaluated by total protein quantification, ELISA assay and protein profiling by electrophoresis-based separation (SDS-PAGE). The autoclaving alone was found to weakly affect almond proteins stability, despite what observed for the combination of hydration and autoclaving, which resulted in a loss of approximately 70% of total protein content compared to untreated sample, and in a final negligible immunoreactivity, as well. The final SDS-PAGE protein pattern recorded for almonds hydrated and autoclaved disclosed significant changes. In addition, the same samples were further submitted to in vitro simulated gastro-duodenal (GI) digestion to evaluate potential changes induced by these processing on allergens digestibility. Digestion products were identified by HPLC-HRMS/MS analysis followed by software-based data mining, and complementary information were provided by analyzing the proteolytic fragments lower that 6 kDa in size. The autoclave based treatment was found not to alter the allergens digestibility, whereas an increased susceptibility to proteolytic action of digestive enzymes was observed in almonds subjected to the combination of prehydration and autoclaving. Finally, the residual immunoreactivity of the GI resistant peptides was investigated in-silico by bioinformatic tools, confirming that by following both approaches, no epitopes survived the almond digestion, thus demonstrating the potential effectiveness of these treatments to reduce almond allergenicity.

The blue sepal color of hydrangea is due to a metal complex anthocyanin composed of 3-O-glucosyldelphinidin (1) and an aluminum ion with the co-pigments 5-O-caffeoylquinic acid (2) and/or 5-O-p-coumaroylquinic acid (3). The three components, namely, anthocyanin, Al³⁺ and 5-O-acylquinic acids, are essential for blue color development, but the complex is unstable and only exists in aqueous solution. Furthermore, the complex did not give analyzable NMR spectra or crystals. Therefore, many trials to determine the detailed chemical structure of the hydrangea-blue complex have failed to date. Instead, via experiments mixing 1, Al³⁺ and 2 or 3 in a buffered solution at pH 4.0, we obtained the same blue solution derived from the sepals. However, the ratio was not stoichiometric but fluctuated. To determine the composition of the complex, we tried direct observation of the molecular ion of the complex using electrospray-ionization mass spectrometry. In a very low-concentration buffer solution (2.0 mM) at pH 4.0, we reproduced the hydrangea-blue color by mixing 1, 2 and Al³⁺ in ratios of 1:1:1, 1:2:1 and 1:3:1. All solution gave the same molecular ion peak at m/z = 843, indicating that the blue solution has a ratio of 1:1:1 for the complex. By using 3, the observed mass number was m/z = 827 and the ratio of 1, 3 and Al³⁺ was also 1:1:1. A mixture of 1, 3-O-caffeoylquinic acid (4) and Al³⁺ did not give any blue color but instead was purple, and the intensity of the molecular ion peak at m/z = 843 was very low. These results strongly indicate that the hydrangea blue-complex is composed of a ratio of 1:1:1 for 1, Al³⁺ and 2 or 3.

The idea of varying constants of nature is very old, and has commanded a lot of attention 1 since first mooted. The variation of the gravitational parameter G and cosmological parameter Λ is still an active area of research. Since the idea of a varying G was introduced by Dirac almost a century ago, there are even theories that have variable G such as Brans-Dicke theory and the scale covariant theory. Both these theories also have a varying Λ in their full generalisations. A varying Λ was also introduced around the same time as that of varying G. It is interesting to note that a possible solution to the cosmological constant problem can be realised from a dynamic Λ. In this work, we focus on a varying Λ and G framework. In almost all studies in the simplest framework of variable Λ and G, it is found that one of them has to increase with time. However, observations and theoretical considerations indicate that both Λ and G should decrease with time. In this paper, we propose a solution to this problem, finding theories in which both Λ and G decrease with time.

Agricultural intensification through simplification and specialisation has homogenised diverse landscapes, reducing their heterogeneity and complexity. While the negative impact of large, simplified fields on biodiversity is well-documented, the role of landscape structure in mitigating and stabilising climate is becoming increasingly important. Despite considerable knowledge of landscape cover types, the understanding of how landscape structure influences climatic characteristics remains limited. To explore this further, we studied an area along the Czech-Austrian border, where socio-political factors have created stark contrasts in landscape structure, despite similar topography. Using Land Parcel Information System (LPIS) data, we analysed the landscape structure on both sides, and processed eight Landsat 8 and 9 OLI/TIRS scenes from the 2022 vegetation season to calculate vegetation indices (NDVI, NDMI) and microclimatic features (surface temperature, albedo, and energy fluxes). Our findings reveal significant differences between the two regions. Czech fields, with their larger, simpler structure and lower edge density, experience more extreme temperatures and fluctuating energy fluxes, while Austrian fields exhibit greater stability. These patterns are consistent across landscape classes, with Austria’s finer landscape structure providing higher stability throughout the vegetation season. In light of climate change and biodiversity conservation, these results emphasise the need to protect and restore landscape complexity to enhance resilience and environmental stability.

This paper investigates a Local Strategy-Driven Multi-Agent Deep Deterministic Policy Gradient (LSD-MADDPG) method for demand-side energy management systems (EMS) in smart communities. Addressing critical challenges in EMS solutions such as data overhead, single-point failures, nonstationary environments, and scalability, the proposed LSD-MADDPG effectively harmonizes individual building needs with entire community energy management goals. By leveraging and sharing only strategic information among agents, the proposed approach demonstrates to optimize the EMS decision-making processes, while enhancing training efficiency and safeguarding data privacy - a critical concern in the community setting. The proposed LSD-MADDPG has proven to be capable of reducing energy costs and flattening community demand curve by coordinating indoor temperature control and electric vehicle charging schedules across multiple buildings. Comparative case studies reveal that LSD-MADDPG excels in both cooperative and competitive settings, aligning individual buildings’ energy management actions with overall community goals in a fair manner, highlighting its potential for future smart community energy management advancements.

Wind energy is one of the main drivers of the renewable energy market. The wind turbine gearbox, used as a multiplier - is one of the main components directly related to wind turbine efficiency and lifespan. Therefore, the strict control of the gearbox project and its manufacturing processes or even minor improvements in this component heavily and positively impact energy production/generation over time. This work diagnoses a 1.6 MW gearbox fracture mechanics to identify its main reason and how the chain of events took place, leading to the catastrophic failure. The diagnoses underwent numerical simulation (Finite Element Analysis - FEA) and further analysis of the lubrication system, bearings, planetary stage gears, helical stage gears, and high-speed shaft. In conclusion, although the numerical simulation showed high contact stresses between the teeth, the region with the crack nucleated was the top land (tip of the tooth). The most likely factors that led to the premature failure were the missed lubrication for the planetary bearings, lack of gear raw material cleanliness, and excessive case depth at the tip of the sun shaft gear teeth. With the sun gear, planet bearings, and planet gears broken in pieces, those small and large pieces dropped into the oil, between the gears, and into the tooth ring, ending up as a premature gearbox failure.

The article is focused mainly on verifying the suitability of data from experimental milling heat-treated beech wood and on investigation of the effect of technical and technological parameters of milling on the energy consumption of this process. The independent parameters of machining process are cutting speed, feed speed, rake angle, and hydrothermal modification of experimental wood material. Based on analysis of variance it can be argued that the greatest statistically significant effect on energy consumption have cutting speed and rake angle of the tool while the feed speed had the least influence. The measured data of cutting power during milling were used to build a regression model and validate it, while the most suitable type of model with correlation of 87 % is Classification and Regression Tree followed by model created by Random Forests method.

Against the backdrop of the European Union's commitment to achieve climate neutrality by 2050, efforts to improve energy efficiency are being intensified. The manufacturing industry is a key focal point of these endeavors due to its high final electrical energy demand, while simultaneously facing a growing shortage of skilled workers crucial for meeting established goals. Expert systems (ESs) offer the chance to overcome this challenge by automatically identifying potential energy efficiency improvements and thereby playing a significant role in reducing electricity consumption. This paper systematically reviews state-of-the-art approaches of ESs aimed at improving energy efficiency in industry, with a focus on manufacturing. The literature search yields 1668 results, of which 62 articles published between 1987 and 2024 are analyzed in depth. These publications are classified according to the system boundary, manufacturing type, application perspective, application purpose, ES type, and industry. Furthermore, we examine the structure, implementation, utilization, and development of ESs in this context. Through this analysis, the review reveals research gaps, pointing toward promising topics for future research.

Tropical regions face significant energy challenges due to climatic conditions. This study investigates the interplay between sustainable architecture and building energy regulations in mitigating these challenges. The study aims to assess the effectiveness of existing building energy regulations in promoting sustainable architecture in tropical climates and identify key architectural strategies and regulatory frameworks for optimizing energy efficiency in tropical buildings. A comparative analysis of building regulations and case studies of sustainable buildings in selected tropical regions is conducted. The findings reveal that current regulations often must be revised to address tropical climates' unique energy demands. Incorporating passive design principles, renewable energy systems, and material selection is crucial for energy efficiency. It is recommended that building energy regulations be strengthened to mandate sustainable design strategies and provide incentives to promote the adoption of energy-efficient technologies.

In this paper, we investigate various graphene monolayer nanomesh structures (diodes) formed only by nanoholes, with a diameter of just 20 nm and etched from the graphene layer in different shapes (such as rhombus, bow-tie, rectangle, trapezoid, and triangle), and their electrical properties targeting electromagnetic energy harvesting applications. In this respect, the main parameters characterizing any nonlinear device for energy harvesting are extracted from tens of measurements performed on a single chip containing the fabricated diodes. The best nano-perforated graphene structure is the triangle nanomesh one, which exhibits remarkable performance in terms of its characteristic parameters, i.e., a 420 Ω differential resistance for optimal impedance matching to an antenna, a high responsivity greater than 1000 V/W, and a low noise equivalent power of 847 pW/√Hz at 0 V.

The fuel prices are increasing nowadays, causing a burden on the power system. From this, diesel generators that are still in use, must be hybridized with renewable energy (RE) to levelized the overall projects costs. This study aims to schedule an operation of a hybrid system photovoltaic (PV)/ diesel in a remote area which located in Wadi Rum district in Jordan to serve factory load in addition to obtain the best economical system combination that can serve the needs of a continuous electrical load without any interruption. Based on the results of the analysis using HOMER software, the configuration in the system will be a combination between PV modules, and diesel generator. The hybrid system has met the target for electricity production which is documented in upcoming sections.

Automated systems, regulated by algorithmic protocols and predefined set-points for feedback control, require the oversight and fine-tuning of skilled technicians. This necessity is particularly pronounced in automated greenhouses, where optimal environmental conditions depend on the specialized knowledge of dedicated technicians, emphasizing the need for expert involvement during installation and maintenance. To address these challenges, this study proposes the integration of data acquisition technologies using Internet of Things (IoT) protocols and optimization services via Reinforcement Learning (RL) methodologies. The proposed model was tested in an industrial production greenhouse for the cultivation of industrial hemp, applying adapted strategies to the crop, and was guided by an agronomic technician knowledgeable about the plant. The expertise of this technician was crucial in transferring the RL model to a real-world automated greenhouse equipped with IoT technology. The study concludes that the integration of IoT and RL technologies is effective, validating the model's ability to manage and optimize greenhouse operations efficiently and adapt to different types of crops. Moreover, this integration not only enhances operational efficiency but also reduces the need for constant human intervention, thereby minimizing labor costs and increasing scalability for larger agricultural enterprises. Furthermore, the RL-based control has demonstrated its ability to maintain selected temperatures and achieve energy savings compared to classical control methods.

The integration of Industry 4.0 technologies in photovoltaic (PV) installations offers significant potential to enhance efficiency, reliability, and economic viability. This study evaluates the technical and economic impacts of implementing the Internet of Things (IoT), artificial intelligence (AI), and advanced data analytics in PV systems within the residential and industrial sectors in the Region of Murcia. Real-time monitoring technologies based on IoT sensors were analyzed to collect data on the operational performance of pilot PV installations. Advanced data analysis techniques, including machine learning, were analyzed to process the collected data, enabling predictive maintenance, performance optimization, and future production estimation. The study also explored the use of drones and computer vision for automated inspection of solar panels, identifying issues such as hotspots and dirt accumulation. The results demonstrate significant improvements in energy efficiency, system availability, and reduction of failures and downtime. Economic analyses indicate cost savings in operation and maintenance and increased overall system reliability. This research identifies key barriers and opportunities for adopting 4.0 technologies in the PV sector and proposes strategies to overcome challenges and leverage benefits. The findings contribute to the advancement of knowledge and the promotion of sustainable and efficient energy systems in the solar industry.

The growing interest in environmental sustainability issues and, at the same time, the advantages offered by blockchain technology have strong connections between these two topics. This study explores the application of blockchain technology across various environmental domains, such as air quality, climate change impacts, and resource management. The research utilised a dual approach, combining a bibliometric analysis with VOSviewer and a topic analysis using BERT models to assess the discourse within both scientific literature extracted from Scopus and practical blockchain projects obtained from GitHub. The findings reveal that food security, energy, and sustainable agriculture are predominant topics in academic discussions, with a noticeable increase in focus from 2017 onwards. Practical projects are focused on transparent tracking and decentralised management. The overlap between academic and practical spheres is evident in the shared focus on energy and environmental management, demonstrating blockchain’s growing role in addressing global environmental challenges. The study underscores the importance of integrating theoretical research with practical implementations to harness blockchain’s full potential in promoting sustainable environmental practices.

The development of novel ionic liquid crystals for energy storage applications has gained significant attention in recent years due to their potential to develop the field of energy storage. Ionic liquid crystals represent a unique class of materials with high ionic conductivity and thermal stability, making them ideal candidates for use in advanced energy storage devices. This research aims to explore the fundamental properties, structure and liquid crystals performance of these novel materials, with the goal of advancing their practical application in next-generation energy storage technologies. By understanding the structure-function relationship of ionic liquid crystals, researchers can tailor their properties to meet specific energy storage requirements, such as high energy density, fast charging capabilities, and long cycle life. This study seeks to contribute to the growing body of knowledge in the field of energy storage by investigating the potential of novel ionic liquid crystals as efficient and sustainable energy storage solutions. The two ionic liquid crystals show mesomorphic behavior and typical zwitterion characteristics that revealed by the cyclic voltammetry techniques. These materials uploaded with lithium ions for more stability and higher ionic conductivity.

The Internet of Things (IoT) is a promising technology for sensing and monitoring the environment to reduce disaster impact. Energy is one of the major concerns for IoT devices, as sensors used in IoT devices are battery-operated. Thus, it is important to reduce energy consumption, especially during data transmission in disaster-adverse situations. Clustering-based communication helps reduce a node’s energy decay during data transmission and enhances the network’s lifetime. Many hybrid combination algorithms are proposed for clustering and the routing protocol to improve the network lifetime in disaster scenarios. However, the performance of these protocols is widely varied based on the underlying network configuration and the optimisation parameters considered. In this research, we have used the clustering parameters that are most relevant to disaster scenarios, such as the node’s residual energy, distance to sink, and network coverage. Then, we proposed a bio-inspired hybrid (BAO-PSO) algorithm where the Butterfly Optimisation Algorithm (BOA) is used for clustering and Particle Swarm Optimisation (PSO) is used for the routing protocol. The performance of the proposed algorithm is compared with the benchmark protocols LEACH, DEEC, PSO, PSO-GA, and PSO-HAS. Residual energy, network throughput, and network lifetime are considered performance matrices. The simulation result showed that the proposed algorithm increases network lifetime by 10%-20% by comparison with the benchmark algorithm.

Carbon Quantum Dots (CQDs) have emerged as promising nanomaterials for enhancing the performance of supercapacitors, offering unique advantages such as high surface area, excellent electrical conductivity, and tunable surface chemistry. This review provides a comprehensive overview of recent advancements in the synthesis, characterization, and integration of CQDs into supercapacitor devices. Various synthesis methods, including chemical oxidation, hydrothermal/solvothermal methods, microwave-assisted synthesis, and pyrolysis, are discussed, highlighting their impact on the structural and electrochemical properties of CQDs. Characterization techniques such as transmission electron microscopy (TEM), X-ray diffraction (XRD), Raman spectroscopy, and photoluminescence (PL) spectroscopy are elucidated for assessing the morphology, crystallinity, and optical properties of CQDs. The integration of CQDs into supercapacitors, including their utilization in composite electrodes, binder-free electrodes, and doping strategies, is explored to enhance specific capacitance, energy density, power density, and cycle stability of the devices. Challenges and future perspectives in the field are outlined, emphasizing the need for scalable synthesis methods, enhanced electrochemical performance, and sustainable device engineering to realize the full potential of CQD-based supercapacitors for various energy storage applications. This review aims to provide insights into the current state of research and guide future endeavors towards developing high-performance and environmentally sustainable energy storage technologies.

Energy drink (ED) consumption among Israeli-Arab adolescents is widespread. This study aimed to investigate the acute glycemic and insulin effects of EDs in healthy adolescents. Seventy-one Israeli-Arab adolescents (56% girls, average age 16.04±1.03 years) participated in a non-randomized, case-controlled, open-label study. Participants consumed ED (n=36) or a volume- and carbohydrate-matched non-caffeinated soft drink (SD, n=35), followed by a 2 h glucose tolerance test. Blood glucose was measured at baseline and 15, 30, 60, and 120 minutes post-consumption (T0, T15, T30, T60 and T120, respectively). Serum insulin concentration and caffeine relative intensity were determined 45 minutes post-consumption (T45). Blood glucose levels peaked significantly at T15 and remained significantly higher at T30 in the ED group compared to the SD group (p=0.005, p=0.017, respectively). Insulin concentrations were substantially higher at T45 in the ED group (t[64]=2.794, p=0.001). This pattern was especially prominent in heavy ED consumers. A positive correlation emerged between the amount of caffeine consumed (mg/kg), blood glucose levels at T15 and T30, and insulin concentration at T45. This study is the first to demonstrate the glycemic and insulin responses to ED consumption in adolescents, suggesting that regulatory measures limiting ED sales to adolescents could improve their health.

Active galactic nuclei (AGNs), either radio-quiet or radio-loud, had never been observed in X-ray polarized light until the advent of the Imaging X-ray Polarimetry Explorer (IXPE [1]) in the end of 2021. This satellite opened a new observational window for studying supermassive black holes and their complex environment. In this regard, radio-quiet AGNs are probably better targets than radio-loud objects to probe accretion processes, due to the lack of synchrotron emission from jets that can dilute the polarized signal from the central engine. Their relatively clean environment not only allows to detect and measure the X-ray polarization originating from the hot corona responsible for X-ray emission, but also to assess the geometry of the media immediately surrounding the supermassive black hole. Such geometrical measurements work just as well for characterizing the corona morphology in pole-on AGNs as it does for determining the three-dimensional shape of the circumnuclear cold obscurer (the so-called torus) in edge-on AGNs. In this review paper, we will return to each of the observations made by IXPE so far in the field of radio-quiet AGNs and highlight the fundamental contribution of X-ray polarimetry to our understanding of how light is emitted and how matter is shaped around supermassive black holes.

Mechanically homogenized composite of expanded graphite and cobalt(II) rhenate(VII) has been described. Cobalt(II) rhenate(VII) was obtained in a reaction of perrhenic acid with cobalt(II) nitrate. A simple mortar homogenization method was used to enhance intercalation of cobalt species within carbon matrix. The specific capacity of composite was enhanced by 50% in comparison to bare expanded graphite. The electrochemical characteristic was significantly improved including better cyclability, lower resistance of electrode material, lower iR drop, with respect to expanded graphite without cobalt(II) rhenate(VII) active species. Expanded graphite with its unique specific surface area and pore size diameter was proved as potential and cheap carbon support.

Despite energy-related financial concerns and the growing demand for sustainability, many energy efficiency measures are not being implemented in industrial practice. There are a number of reasons for this, including a lack of knowledge about energy efficiency potentials and the assessment of energy savings as well as the high workloads of employees. This article describes the systematic development of an expert system, which offers a chance to overcome these obstacles and contribute significantly to increasing the energy efficiency of production machines. The system employs data-driven regression models to identify inefficient parameter settings, calculate achievable energy savings, and prioritize actions based on a fuzzy rule base. Proposed measures are first applied to an analytical real-time simulation model of a production machine to verify that constraints required for the specified product quality are met. This provides the machine operator with the expert means to apply proposed energy efficiency measures to the physical entity. We demonstrate the development and application of the system for a throughput parts cleaning machine in the metalworking industry.

This study explores the potential of piloting desalination plants in a systematic way to evaluate energy improvements in water desalination processes. Pilot tests with the latest generation of reverse osmosis membranes in large desalination plants are becoming increasingly common, as small-scale experiments are carried out on the operation of new generation membranes with better salt rejection and lower energy consumption. This approach aims to achieve optimal water quality standard at the lowest possible cost. In this way, pilot tests are being carried out before the decision is made whether to change the reverse osmosis membranes, as this represents a significant investment. By carrying out these tests, we hope to minimize the risk of making a mistake to ensure the best results in terms of energy consumption, operating costs and reducing the environmental impact while complying with the required water quality. In this case, the Pareto analysis is used to identify the two or three most significant causes whose treatment affects more than 80% of the possible energy improvement to be implemented. This article introduces a novel approach to studying a total of 180 desalination plants at the territorial level in the Canary Islands. The global scarcity of freshwater resources has greatly contributed to the development of desalination technologies, in which reverse osmosis is one of the most widely used and highly regarded methods.

In the intersection of the Internet of Things (IoT) and Machine Learning (ML), the choice between high-level and low-level programming libraries presents a significant dilemma for developers, impacting not only the efficiency and effectiveness of ML models but also their environmental footprint. We have proposed a comprehensive framework to aid in this decision-making process, underpinned by a detailed comparative analysis of both types of libraries on one of the key IoT ML task; image classification. We have introduced a novel algorithm designed to calculate the green footprint of ML model training, factoring in execution time, memory utilization, power consumption, and CPU temperature, addressing the urgent need for sustainable ML practices. Through an empirical evaluation of popular libraries such as PyTorch for high-level and Libtorch for low-level development, we have assessed their performance, development efficiency, and hardware compatibility. The culmination of our research is a decision support system that synthesizes the experimental findings to guide developers toward choices that harmonize model performance with environmental sustainability.

Dual-energy CT (DECT) imaging has broadened the potential of CT imaging by offering multiple postprocessing datasets with a single acquisition at more than one energy level. DECT shows profound capabilities to improve diagnosis based on its superior material differentiation and its quantitative value. However, the potential of dual energy imaging remains relatively untapped, possibly due to its intricate workflow and intrinsic technical limitations of DECT. Knowing the clinical advantages of dual-energy imaging and recognizing its limitations and pitfalls is neces-sary for an appropriate clinical use. The aims of this paper are to review physical and technical basis of DECT acquisition and analysis, to discuss advantages and limitations of DECT in dif-ferent clinical scenarios, to review technical constraints in material labeling and quantification, and to evaluate cutting-edge applications of DECT imaging, including artificial intelligence, qualitative and quantitative imaging biomarkers, and DECT-derived radiomics and radioge-nomics

As modern technologies, particularly home assistant devices, become more integrated into our daily lives, they are also making their way into the domain of energy management within our homes. Homeowners, now acting as prosumers, have access to detailed information in 15-minute or even 5-minute intervals, including weather forecasts, outputs from Renewable Energy Sources (RES)-based systems, appliance schedules and the current energy balance, which details any deficits or surpluses along with their quantities and the predicted prices on the Local Energy Market (LEM). The goal for these prosumers is to reduce costs while ensuring their home’s comfort levels are maintained. However, given the complexity and the rapid decision-making required in managing this information, the need for a supportive system is evident. This is particularly true given the routine nature of these decisions, highlighting the potential for a system that provides personalized recommendations to optimize energy consumption, whether that involves adjusting the load or engaging in transactions with the LEM. In this context, we propose a recommendation system powered by Large Language Models (LLM), Scikit-llm and Zero-Shot Classifiers, designed to evaluate specific scenarios and offer tailored advice for prosumers based on the available data at any given moment. Two scenarios for a prosumer of 5.9 kW are assessed using candidate labels, such as Decrease, Increase, Sell and Buy.

This scientific article outlines the Artificial Intelligence Integrated Energy Education Framework (AI-IEEF), a transformative model designed to revolutionize energy education and management practices. The framework is organized into five distinct layers: Organizational (AI-enhanced administration systems), Financial (dynamic AI financial models), Technology (advanced simulation and modeling), Methodology (AI in curriculum development and personalized learning), and Social (AI for community engagement and impact). An expert panel used the fuzzy Delphi method to achieve consensus on twenty key factors within these layers, establishing a solid foundation for analysis. Following this, the Fuzzy Analytic Hierarchy Process (AHP) was employed to calculate precise weights for each layer and their respective factors, providing a quantitative assessment of their relative importance. These weight calculations are crucial, as they guide resource allocation and strategic decision-making to ensure the framework is optimized for the evolving needs of energy management. Furthermore, the article introduces five tailored variants of the AI-IEEF, each addressing specific aspects of energy education and offering a comprehensive approach to navigating the challenges in the field. The five variants include the Smart Campus Energy Education, Global Energy Policy Analysis, Renewable Energy Research and Development, Energy Workforce Development, and Community Engagement and Outreach variants. Each provides a distinct approach to energy education, from transforming campuses into living labs for hands-on learning to fostering international collaborations that explore the global implications of energy policy. These variants emphasize practical skills, policy analysis, and community-focused solutions, ensuring that students are well-prepared to contribute effectively to the energy sector.

In areas with a deep floor plan, the distribution of natural light is not uniform. Consequently, relying solely on daylight may not suffice to meet the space's lighting requirements, necessitating the use of artificial lighting in darker areas. Therefore, a lighting system is needed that not only controls the glare near the windows but also increases the light at the end of the room and provides uniform daylight. One of the widely used systems is the “light shelf“which has three main functions: shading, increasing the depth of light penetration and reducing glare. Review articles about light shelves have been done in 2015 and 2017, while more than 80% of the studies have been carried out since 2016 and light shelves with more diverse forms and dynamic elements and many consolidations were proposed. Therefore, there is a need for a more comprehensive review. The main question of this research is how different parameters (including climate, material, ceiling and integrated systems) can help to increase the efficiency of light shelves. By using a systematic review, studies in the past three decades were classified in order to determine the effect of these parameters on improving lighting performance and controlling solar heat gain.

Using the phenomenon of transpiration, plants are able to raise soil water to a height of about 100 meters. According to the Cohesion - Tension theory, water moves through the capillaries of plant along a gradient of negative water potential in a single unified flow along a single route from roots to leaves, entering on its way into living cells for their nutrition and evaporating into the atmosphere in significant amounts in the leaves. The paper shows that in a case of artificial transpiration devices (ATD), the flow of rising water can be divided into two streams - the transpiration stream and the passive water stream - and as a result, such devices become capable of raising water to any given height. As proof, the working variant of two-stream ATD is proposed. The development of this ATD was carried out in two stages, discussed in details in the paper. At the first, experimental stage, a physical model was designed and manufactured, in which the flow of rising water was divided into two streams moving along two independent routes. The first route is used exclusively for the purpose of transpiration of water - transporting it into an artificial evaporator for complete evaporation into the atmosphere. The second route is used exclusively to transport passive water using the energy obtained in the first route during the process of transpiration. During many hours of testing, the physical model demonstrated a stable ability to bring masses of passive water, maintaining normal atmospheric pressure in them, to a small height, even in the extreme case not exceeding 10 meters. At the second, analytical stage, this two-stream model was developed into a two-stream multi-stage model, capable of raising water to any given height by choosing the number of stages. The number of stages can be very large, and portions of water can be delivered to any given height, remaining under normal atmospheric pressure. The conclusion part of the paper discusses the prospects of creating on the basis of the developed two-stream ATDs large systems that can, using the phenomenon of transpiration, become a sources of clean energy, similar to how it is realized in the mass of plants.

We study in detail the influence of different chemical potentials (baryon, charged, strange, and neutrino) on how and how fast a free gas of quarks in the zero-temperature limit reaches the conformal limit. We discuss the influence of non-zero masses, the inclusion of leptons, and different constraints, such as charge neutrality, zero-net strangeness, and fixed lepton fraction. We also investigate for the first time how the symmetry energy of the system under some of these conditions approaches the conformal limit. Finally, we briefly discuss what kind of corrections are expected from perturbative QCD as one goes away from the conformal limit.

This article presents multiple novel and compelling arguments to systematically disprove two widely accepted notions: one is that entropy is a measure of disorder, and the other is Schrödinger's notion of negative entropy (negentropy). These two notions have been cited hundreds of times annually in scientific literature for decades. To mathematically describe the second law of thermodynamics, the concept of entropy was created and defined in the 1860s as heat energy divided by thermodynamic temperature, and the entropy of an object increases when it absorbs heat. This is the uncontroversial and fundamental nature of entropy, which is pivotal to current thermodynamics and from which multiple facts are deduced. These facts consistently disprove the above two notions. Some biological facts, such as the one that life orderliness is encoded and provided by inherited genes rather than entropy decline, can also disprove Schrödinger's negentropy notion. Moreover, this article further clarifies the reasoning errors of the two notions. It also shows that the tendency of many natural or social systems to become more disordered over time does not result from the second law of thermodynamics.

The reduction of PV prices and interest in energy independence accelerate the adoption of residential battery storage. This storage can support various functions of an energy system undergoing decarbonization. In this work, operative benefits of the storage from the system perspective, namely, generation cost reduction and congestion mitigation, are investigated. Germany is chosen as a case study due to its strong reliance on variable renewable energy. For the analysis, an economic dispatch model with a high spatial resolution is coupled with a Pan-European transmission grid model. It is shown that the system's generation costs are highest when the assets are used only to maximize the PV self-consumption, and the costs are lowest when the storage also reacts to the market dynamics. This amounts to 6% cost reduction. Both operation strategies result in an equal level of grid congestion and infrastructure loading. This is improved with a strategy that accounts regional peak reduction as a secondary objective. The high congestion level emphasizes the grid expansion need to keep pace with the generation and electrification expansion necessary to decarbonize other sectors. Lastly, policymakers should enable multipurpose utilization, e.g., via the introduction of market-oriented retail electricity prices with intervention options for grid operators.

The emergence of Distributed Ledger Technology (DLT) in the past decade has challenged our imagination to discover new, innovative and disruptive solutions to problems in domains ranging from finance and healthcare to supply chain and smart cities. However, the enormous energy consumption that has been observed in some of the most successful DLT applications raises the question of their long term sustainability. This article reviews the standardization efforts of the International Telecommunications Union (ITU) to provide guidelines to regulators and policy makers for making informed decisions on the applicability and sustainability of DLT architectures from the point of view of energy consumption.

Due to the continued deepening of today’s mining projects, there is a need to develop new or improved rockbolts that are strong and yielding and have high energy absorption when exposed to dynamic loading. Impact tests can provide useful information about the dynamic response of rockbolts but most laboratory tests involve high costs in preparation and result validation. Numerical modeling is an alternative that, in addition to complementing laboratory results, can be used to represent the process of deformation and energy absorption of support elements. In this paper the implementation and results obtained from a finite difference (FDM) numerical model are presented. The model functions as a simulation tool to illuminate all the elements that conform the large-scale (1:1) impact test and their behavior and influence on the dynamic response of a threadbar bolt (22 mm nominal diameter). The model was calibrated using published results and based on these results as well as parametric analysis, the response of each component (steel tube, grout, and bolt) could be identified and its behavior in terms of absorbed energy and displacement could be observed. Results show the model can provide important preliminary information to make design decisions about support elements design.

Scientific studies on the impact of wood species on solid fuel production, performance, and sustainability are grossly inadequate. The knowledge of this is imperative as users of solid fuels are increasing rapidly, especially in Africa. On this note, it becomes necessary to explore measures that will improve its efficiency and sustainability as an energy source. This study investigates some properties of selected wood species used as an energy source in Nigeria and their pelleting potential. Nine (9) samples were characterized and assessed for suitability of pelleting following four wood pellet quality standards. The findings revealed Anogeissus leiocarpus as the species with the best rating score in terms of fuel properties while Vitellaria paradoxa as the lowest. However, in terms of conformity with the four wood pellets standards, Khaya senegalensis, Parkia biglobosa and Anogeissus leiocarpus having presented density, calorific value, sulfur, arsenic, cadmium, and lead within the limits of the wood pellet quality standards were considered the best wood species in terms of fuel suitability and pelleting potential. The findings therefore suggest that not all wood species are suitable as fuel. Thus, for species that do not meet the standard wood pellet requirements, alternatives such as the use of biomass blends, additives, or process adjustments can be employed to adapt the quality to the standards or by using the fuels in improved cookstoves.

In this work, we explore new constraints on phantom scalar field cosmologies with a scalar field employing early times catalogues related to CMB measurements, along with the local standard observables, like Supernovae Type Ia (SNIa), H(z) measurements (Cosmic Clocks), and Baryon Acoustic Oscillations (BAO) baselines. In particular, we studied a tracker phantom field with hyperbolic polar coordinates that have been proposed in the literature. The main goal is to obtain precise cosmological constraints for H0 and σ8, in comparison to other constructions that present tension in early cosmological parameters. Our results show that phantom scalar field cosmologies have a reduced statistical tension on H0 that it is less than 3σ using model-independent CMB catalogues as SPT-3G+WMAP9 and ACTPol DR-4+WMAP9 baselines. This suggests these models using a different phantom potential might address the Hubble constant problem and reduce the systematics involved.

Many studies discuss carbon-based materials because of the versatility of its element. They include different opinions for scientific problems and discuss fairly at convincing and compelling levels within the scope and application. A gas-state carbon atom converts into various states depending on its conditions of processing. The electron transfer mechanism in the gas-state carbon atom is responsible to convert it into various states, namely, graphite, nanotube, fullerene, diamond, lonsdaleite and graphene. The shape of ‘energy trajectory’ enables transferring electrons from the left- and right-sides of an atom is like a parabola. That ‘energy trajectory’ is linked to states (filled state and suitable nearby unfilled state) where force-exertion along the poles of transferring electrons is remained balance. So, the mechanism of originating different states of a gas-state carbon atom is under the involvement of energy first. This is not the case for atoms executing confined inter-state electron-dynamics as the force is involved first. Graphite-, nanotube- and fullerene-state atoms ‘partially evolve partially develop’ (form) their structures. These possess one-dimensional, two-dimensional and four-dimensional ordering of atoms, respectively. Their structural formation also comprises ‘energy curve’ having a shape-like parabola. Transferring suitable filled state electron to suitable nearby unfilled state is under a balance force exerting along the poles. The graphite structure under only attained-dynamics of atoms can also be formed but in two-dimension. Here, binding energy between graphite-state carbon atoms is for a small difference of exerting forces along their opposite poles. Structural formation in diamond, lonsdaleite and graphene atoms involve energy to gain required infinitesimal displacements of electrons through which they maintain orientationally-controlled exerting forces along dedicated poles. In this study, the growth of diamond is found to be south to east-west (ground) where atoms bound ground to south. Thus, diamond atoms merge for a tetra-electron ground to south topological structure. Lonsdaleite atoms merge for a bi-electron ground to just-south topological structure. The growth of graphene is found to be north to ground where atoms bound ground to north. Thus, graphene atoms merge for a tetra-electron ground to north topological structure. Glassy carbon exhibits layered-topological structure where, tri-layers of gas-, graphite- and lonsdaleite-state atoms successively bind in repetitive order. Nanoscale hardness is also sketched based on different force-energy behaviors of different state carbon atoms. Here, structure evolution in each carbon state atom explores its own science.

As the adoption of renewable energy sources grows, ensuring a stable power balance across various time frames has become a central challenge for modern power systems. In line with the "dual carbon" objectives and the seamless integration of renewable energy sources, harnessing the advantages of various energy storage resources and coordinating the operation of long-term and short-term storage have become pivotal directions for future energy storage deployment. To address the complexities arising from the coupling of different time scales in optimizing energy storage capacity, this paper proposes a method for energy storage planning that accounts for power imbalance risks across multiple time scales. Initially, the Seasonal and Trend decomposition using the Loess (STL) decomposition method is utilized to temporally decouple actual operational data. Subsequently, power balance computations are performed based on the obtained data at various time scales to optimize the allocation of different types of energy storage capacities and assess the associated imbalance risks. Finally, the effectiveness of the proposed approach is validated through hourly applications using real-world data from a province in China over recent years.

A Friedmann-Lemaitre-Robertson-Walker space-time model with all curvatures k=0,±1 is explored in f(R,T) gravity. The solutions are obtained via the parametrization of the scale factor that leads to a model transiting from a decelerated universe to an accelerating one. The physical features of the model are discussed and analysed.

Energy consumption modelling is of critical importance for improving energy efficiency in the drive towards sustainable manufacturing. Modern manufacturing processes and machine tools are very complex as they involve interplay of several advanced technologies. Therefore, energy modelling of modern machine tools is a complex multi-disciplinary task. This paper proposes a systematic and practical framework to choose the appropriate modelling approach for a given industrial problem. The framework was validated by applying it to diverse industrial scenarios.

The global energy landscape is undergoing a transformative shift, and the potential of LNG as a major energy source is a topic of intense debate. In order to meet the growing demand for sustainable energy supply, it is crucial to maximize the efficiency and environmental friendliness of the LNG supply chain. This research aims to leverage computational modeling and optimization techniques to enhance the production units involved in LNG production. By harnessing the power of advanced algorithms and simulations, we can identify and implement innovative strategies that minimize energy consumption, reduce greenhouse gas emissions, and enhance the overall sustainability of LNG. Through this study, we seek to uncover novel approaches to address the challenges faced by the LNG industry, including improving operational efficiency, optimizing liquefaction processes, and enhancing the utilization of natural resources. By integrating cutting-edge computational tools and considering environmental factors, we aspire to pave the way for a more sustainable and environmentally friendly future powered by LNG. By exploring the immense potential of computational modeling and optimization, we strive to contribute to the ongoing efforts in advancing energy sustainability and shaping the future of LNG as a crucial global energy source."In this paper, our focus is on simulating and optimizing the process of converting natural gas to LNG. Our goal is to achieve the minimum energy consumption per ton of LNG produced. Through our research, we have identified that utilizing a three-stage exchanger is the most effective approach for minimizing energy consumption in an LNG industrial production unit. Moreover, we have discovered that the outlet pressure from the compressor and the type of refrigerant in the cooling system play significant roles in determining the rate of energy conservation. By carefully considering these factors and optimizing their settings, we can further enhance the overall energy efficiency of the LNG production process. Our research aims to provide valuable insights and guidance to industry professionals and decision-makers in the LNG sector. By implementing the findings of this study, we can contribute to the sustainable development and utilization of LNG as a cleaner and more environmentally energy source. Friendly It's great to see the optimized parameters for the refrigerants and pressure settings in the liquefaction and subcooling cycles. With the mass fraction of 0.89 for methane and 0.14 for ethane in the liquefaction cycle, and 0.59 for methane and 0.3 for nitrogen in the composition for achieving energy efficiency in the LNG production subcooling cycle, The optimized outlet pressure of 650 kPa for the compressors in the liquefaction cycle and 1800 kPa for the subcooling cycle furtherr ccontribute to minimizing energy consumption. Based on your findings, the amount of consumed energy at 14.81 kW per ton of produced LNG highlights the success of the optimization efforts. Reducing the energy consumption per ton of LNG produced is a significant accomplishment towards achieving energy sustainability and environmental friendliness in the LNG industry. These results demonstrate the importance of computational modeling and optimization in identifying the best parameters for eenhancing energy efficiency in LNG production. By implementing these optimized settings, we can work towards a more sustainable future with reduced energy consumption and lower environmental impact

Resource pricing in cloud computing has become one of the main challenges for cloud providers. The challenge is determining a fair and appropriate price to satisfy users and resource providers. To determine a fair price, it is necessary to consider the conditions and needs of both parties: provider and user. This research tries to provide a pricing mechanism for cloud computing based on game theory. The proposed mechanism takes into account three factors including fault possibility, interaction between virtual machines, and energy consumption to reach a fair price. In the proposed game, the provider decides on the price of the virtual machine which can be offered to the user on each physical machine and the user decides between the virtual machines offered to run its application. The whole game is implemented as a function of the resource broker component. The proposed mechanism is simulated and evaluated using the CloudSim simulator. Its performance is compared with several previous recent mechanisms. According to the results, the proposed mechanism has been able to determine a more reasonable price for the user and the provider which increases the overall profitability of the cloud system.

We propose a toy model of a spherical universe made up of an exotic dark gas with temperature $T$ in thermal equilibrium with a black-body. Each particle of this exotic gas mimics a kind of particle of dark energy. So, each dark particle occupies a very small area of space so-called Planck area $L_p^{2}$, which represents the minimum area of the whole space-time given by the spherical surface with area $4\pi R_H^2$, where $R_H$ is the Hubble radius. We realize that such spherical surface is the surface of the black-body for representing the dark universe as if it were the surface of an expanding balloon. Thus, we are able to derive the law of universal gravitation, thus leading us to understand the cosmological anti-gravity. We estimate the tiny order of magnitude of the cosmological constant and the acceleration of expansion of the dark sphere. In this toy model, as the dark universe can be thought of as a large black body, when we obtain its power and frequency of emission of radiation, we find very low values. We conclude that such radiation and frequency of the black body made up of dark energy is a background gravitational wave with very low frequency in the order of $\sim 10^{-17}$Hz due to the slight stretching of the fabric of space-time.

This work presents the design, construction and performance evaluation of a photovoltaic greenhouse as an energy hub (EH) in modern agriculture that integrates battery energy storage (BES) and an electric vehicle charging station (EV). The greenhouse is composed of 48 semi-transparent PV panels with nominal transparency of 20% and 110 W capacity. The control of the PV greenhouse as EH was approached as an optimization problem with the aim of minimizing the cost of the energy used from the grid. Simulation results indicate that the integrated BES is capable of balancing power transactions within the microgrid. In addition, it was found that the case of slow charging of the EV at night was less demanding on the BES than fast charging during the day in terms of abrupt power transitions and average depletion of BES SOC (61% vs 53%). Empirical results also demonstrated the negative impact of dust generated by agricultural activity on the performance of solar panels. For a period analyzed of three years, an average yearly production loss of 6.8% was calculated.

A study on flywheel geometries is presented here with the use of finite element modelling (FEM) simulations. The study analyses the stress behaviour of flywheel rotors subject to the rotational speed that creates the maximum stress that the flywheel can support, and then calculates the rotational energy mass ratio (energy density) for each geometry. The obtained geometry was Gaussian section for the Flywheel rotor. The used material for the simulations is carbon fibre Hexcel UHM 12000. The best results were a rotational speed of ≈279.000 rpm and rotational energy density of ≈ 440 Wh/kg for a single disk, but this keeps the total energy low. To increase the total energy, Flywheels with 2 and 3 rotors were analysed. Then the stability under rotation of these Flywheels were analysed, some instability was found and a solution was presented.

The development of biofortified and stress tolerant common bean lines contribute to counteract micronutrient malnutrition in the current condition of climate variability. Our objective was to evaluate the adaptive responses of biofortified common bean (Phaseolus vulgaris L.) lines under acidic soils and high temperature stress conditions in the Amazon region of Colombia. Adaptive responses were evaluated based on phenological, physiological and agronomic differences under combined stress conditions. A total of 247 common bean lines from the Mesoamerican gene pool were evaluated under field conditions at Florencia, Caquetá, Colombia. The common bean lines evaluated included 146 from F4 families with high iron (Fe) content and 99 common bean lines from F5 families that were obtained from simple crosses, double crosses and backcrosses among different bean lines. Lines with tolerance to combined stress conditions of acidic soil and high temperature were found with grain yields greater than 1,400 kg ha-1 from the F5 (lines: 859, 805, 865, 657) and F4 (lines: 2853, 2796) families. This improved agronomic response is likely due to the greater partitioning of photosynthates from canopy biomass (CB) toward pod formation (pod partitioning index, PPI) and grain filling (pod harvest index, PHI; harvest index, HI), which translated into higher grain yields (GY). GY was correlated with CB (r = 0.36), PPI (r = 0.6), PHI (r = 0.68), and HI (r = 0.8, P&lt;0.001). The physiological responses that contributed toward superior agronomic performance of biofortified common bean lines include greater allocation of energy to the photosynthetic machinery (ΦII) and its dissipation in the form of heat (ΦNPQ) as the leaf temperature differential (LTD) increased under combined stress conditions. Six biofortified common bean lines (F5 lines: 859, 805, 865, 657; F4 lines: 2853, 2796) were identified with multiple stress resistance traits and these lines can serve as parents for further genetic improvement of common bean for multiple stress tolerance in the Amazon region of Colombia.

Among the electrochemical energy storage (EES) technologies, rechargeable batteries (RBs) and supercapacitors (SCs) are the two most desired candidates for powering a range of electrical and electronic devices. The RB operates on Faradaic processes, whereas the underlying mechanisms of the SC vary as non-Faradaic in the electrical double layer capacitors (EDLCs), Faradaic at the surface of the electrodes in the pseudo capacitors (PCs), and a combination of both non-Faradaic and Faradaic in the hybrid capacitors. The EDLCs offer high power density but low energy density. The hybrid capacitors take advantage of the Faradaic process without compromising their capacitive nature. Unlike batteries, supercapacitors provide high power density and numerous charge-discharge cycles; however, their energy density lags that of batteries. Here, we review recently published critically selected articles on supercapatteries, a generic term that refers to EES devices that can combine the merits of EDLCs and RBs. Also discussed are the properties, design strategies, and future perspectives of supercapatteries.

In this study, we focused on the eco-driving of electric vehicles (EVs). The target vehicle is an electric bus developed by our research team. Using the parameters of the bus and speed pattern optimization algorithm, we derived the EV eco-driving speed pattern. Compared to eco-driving of internal combustion engine vehicles (ICVs), we found several different characteristics. We verified these characteristics with actual vehicle driving test data of the target bus, and the results confirmed its rationality. The EV eco-driving method can improve electricity consumption by about 10% - 20% under the same average speed.

As urbanization continues to accelerate, the concept of smart buildings has transitioned from a futuristic vision to an integral component of modern cities. These buildings, often seen as the building blocks of smart cities, are increasingly relying on cutting-edge technologies like 5G and cloud computing to reach unprecedented levels of energy efficiency, sustainability, and occupant comfort. This paper offers a comprehensive exploration into the marriage of smart building technologies with 5G and cloud computing. It scrutinizes the individual and combined impacts of these technologies, presents various case studies showcasing real-world applications, and anticipates future trends. Moreover, it delves into technical challenges, policy implications, and offers concrete recommendations for stakeholders.

Studies involving vortex in hybrid superconducting devices and their interaction with different components inside the sample are an important issue to reach higher values of their critical parameters in superconducting materials. The vortex distribution on each side of sample with different fundamental parameters, such as temperature T, penetration depth λ, coherence length ξ, electron mass m and the order parameter Ψ, may help to improve the superconducting properties. Thus, in this work, we used the modified Ginzburg-Landau theory to investigate hybrid superconductor (HS), but also to provide a highly tunable and adjustable theoretical tool to theoretically explain the experimental results involving HS, in order to study the vortex behaviour in superconductors of mesoscopic dimensions with extremely differences among their fundamentals parameters. Therefore, we evaluated the influence of HS on vortex configuration and their effects in the field-dependent magnetization. The results show that the during the increment of applied magnetic field H the diamagnetic response of HS, Meissner effect, include additional jumps of magnetization while diamagnetism continues its increase in the sample. In addition, the differences among parameters, create an interface between both components, two different magnitudes of supercurrent and vortex sizes producing a lower degradation of local superconductivity, which increase the upper critical field. On the other hand, this type HS with differences of parameters on both sides can be used to control the vortex movement in the selected superconducting region sample with more accuracy.

AbstractTo overcome the negative impacts on the environment and other problems associated with fossil fuels have forced many countries to inquire into and change to environmentally friendly alternatives that are renewable to sustain the increasing energy demand. Solar energy is one of the best renewable energy sources with the least negative impacts on the environment. Different countries have formulated solar energy policies to reduce dependence on fossil fuel and increasing domestic energy production by solar energy. According to the 2010 BP Statistical Energy Survey, the world cumulative installed solar energy capacity was 22928.9 MW in 2009, a change of 46.9% compared to 2008. In this study, a PV generation system has been modeled and installed considering uncertain whether based on the hourly wind speed data of New York City (NYC) of year 2014. Regression models has been used to forecast the hourly, weekly, and monthly wind speed of NYC year 2014. Design of experiment (DOE) has been used to determine the optimal panel size (area), the battery capacity size, and other levels of factors.

The present paper reports an exact approach quantifying the electromagnetic contribution to the anomalous magnetic moment occurring in isolated system comprised of non-composite particle carrying elementary electric charge. Essential averaging procedure and regularization of the electromagnetic field potentials necessary when quantifying the electromagnetic self-interactions and when deriving equations of motion without singularities and obeying the conservation laws are thoroughly discussed. The study shows that the dynamics of the considered system is associated to unique classical transcendental equations of motion satisfied by the particle's velocity and the electromagnetic contribution to the anomalous $g$-factor known from the quantum electrodynamics. The equations of motion lead to an exact analytical expression for the anomalous $g$-factor that provides more accurate result than that calculated with the aid of quantum electrodynamics. It matches the experimentally measured value reported in the literature to a one part per trillion. We obtain a_e=0.00115965218000(65) thus reveling the potential of non-perturbative, non-probability methods in predicting the electron's anomalous g-factor.

The study investigates the impact of globalization, renewable energy consumption and economic growth on CO2 emissions in 26 European Union (EU) countries for the period 1990-2020. The second-generation panel unit root tests are applied, the Westerlund cointegration test is used, and panel Fully Modified Least Squares (FMOLS) and Dynamic Ordinary Least Squares (DOLS) techniques are employed to estimate the long-term relationship between variables. The causality relationship among variables under investigation is identified by the heterogeneous Dumitrescu-Hurlin causality test. It is found that globalization and renewable energy consumption contributed to the carbon emissions mitigation, while economic growth induced their increase. The results are robust when control variables (i.e., financial development, foreign direct investment and urbanization) are added in the model. Foreign direct investment and urbanization are contributors to carbon emissions increase whereas financial development induce their decrease. The effect of variables under consideration on carbon emissions is differentiated by the economic development and institutional quality level. Unidirectional causalities relationships were identified from globalization to carbon emissions and from carbon emissions to foreign direct investment and bidirectional relationships between economic growth, renewable energy consumption, financial development and carbon emissions. Policy implications of the findings are also discussed.

Abstract: A fertilisation experiment with aim to determine the effect of different potassium fertiliser rates and their interaction with nitrogen and phosphorus on field rotation productivity, potassium balance, fertiliser utilization and changes in content of potassium in soil was carried out in Lithuania between 1971 and 2020. The multi-factorial scheme with 45-treatment plots, where seven (including zero) rates of nitrogen, phosphorus and potassium fertilisers were studied. The experimental treatments during the study period included winter wheat, spring wheat, spring barley, sugar beet, spring rapeseed, annual and perennial grasses. It was found that potassium fertilisers was the most effective on agricultural crops when used in combination with other major plant nutrients – nitrogen and phosphorus. The balance of potassium (K2O) in soil, when nitrogen and phosphorus fertilisers were applied together, to compensate for potassium removal, when applying low nitrogen (N) 72 kg ha-1 and phosphorus (P2O5) 64 kg ha-1 fertiliser rates, 128 kg ha-1 of potassium fertilisers is required. When using high nitrogen 180 kg ha-1 and phosphorus 160 kg ha-1 fertiliser rates, 160 kg ha-1 of potassium is needed. The highest potassium uptake, reaching 51.6%, was achieved when plants had been fertilised with nitrogen 108 kg ha-1, phosphorus 96 kg ha-1, and potassium 96 kg ha-1. When fertilising with potassium fertilisers alone, the content of plant available K2O content in the soil increased, while fertilisation with nitrogen and phosphorus combined it’s decreased, except in the plots where the plants had been fertilised with potassium fertiliser at rates of 128 kg ha-1 and higher. Due to the influence of fertilizers, the amount of non-exchangeable potassium in the soil also increased, but relatively less compared to the amount of available potassium content.

The dissolution of Al2O3 non-metallic inclusions from slag containing FexO was investigated in this study. The slag system used in the experiments was a quaternary system of CaO-SiO2-Al2O3-FexO. The composition of the slag was studied by fixing the basicity (CaO/SiO2 ratio) to 1 and varying the FexO content to 10 and 20wt%. In addition, the experimental temperature was varied as 1550℃, 1575℃, and 1600℃ to study the effect of temperature on the Al2O3 dissolution behavior. The experimental equipment is a single hot thermocouple apparatus. The dissolution rate of Al2O3 particles increased linearly with increasing temperature and FexO content. In addition, the mass transfer activation energy of Al2O3 dissolution in FexO 10wt% and FexO 20wt% was calculated by an Arrhenius type analysis. The obtained mass transfer activation energies were 159 and 189 kJ/mole, respectively.

This investigation delves into an examination of the growth dynamics observed in Central Taiwan Science Park (CTSP) and Silicon Glen in Scotland, with a specific focus on their energy, environmental, and economic management. The aim is to predict and evaluate the latest advancements and applications of technology. In terms of energy, CTSP focuses on Taiwan's supply security and green transformation challenges, while Silicon Glen emphasizes Scotland's wind energy generation technologies. Both regions are committed to the development of renewable energy and smart grids. Regarding environmental aspects, CTSP and Silicon Glen prioritize environmental protection and sustainable development by implementing measures for environmental monitoring. In terms of economic management, CTSP, and Silicon Glen serve as key technology industry hubs This investigation delves into an examination of the growth dynamics observed in Central Tai-wan Science Park (CTSP) and Silicon Glen in Scotland, with a specific focus on their energy, environmental, and economic management. The aim is to predict and evaluate the latest advancements and applications of technology. In terms of energy, CTSP focuses on Taiwan's supply security and green transformation challenges, while Silicon Glen emphasizes Scotland's wind energy generation technologies. Both regions are committed to the development of renewable energy and smart grids. Regarding environmental aspects, CTSP and Silicon Glen prioritize environmental protection and sustainable development by implementing measures for environmental monitoring. In terms of economic management, CTSP, and Silicon Glen serve as key technology industry hubs in Taiwan and Scotland, respectively, attracting numerous high-tech and startup enterprises. Various means facilitate the growth of industries and foster innovations in different industrial spheres. Important factors contributing to this growth include policy support, availability of research materials, and provision of infrastructure. This research paper compares the successful case studies of two industrial parks, along with their environmental and economic management strategies. It explores the management principles that ensure the sustainable development and economic growth of industrial parks, aiming to assist decision-makers and relevant stakeholders in evaluating the sustainable development planning of industrial parks.

This study focused on the predictive models incorporating machine learning techniques that induce new dynamics for forecasting energy generation, enabling effective planning, financing, and system monitoring. The research developed a machine learning-based power generation prediction model tailored explicitly for Kenya's Garissa solar power plant. The selected model demonstrated a root mean squared error of 5.23 during evaluation, resulting in a prediction accuracy of 90.42%. This high accuracy indicates that the model can be relied upon for precise generation prediction, facilitating effective planning, and system performance monitoring

With the swift advancement of wearable electronic devices and the electronic textile industry, the energy storage components of these devices must possess the capability to maintain stable mechanical and chemical properties even after undergoing multiple bending or tensile deformations. This circumstance has expedited research efforts toward novel materials, processing techniques, and designs for flexible energy storage devices. Among the myriad of materials investigated thus far, biomass-derived architectures have garnered significant attention due to renewability, cost-effectiveness, and abundance in earthly resources. Notably, flexible carbon membrane/ monolithic derived from biomass serve as a particularly promising option for self-supporting electrodes, align seamlessly with the requirements of next-generation electronic devices, and obviate the need for additional costs, unnecessary weight, and the high contact resistance that additive insulating adhesives may entail. This review delves into the comprehensive analysis of biomass feedstocks and methodologies employed in the synthesis of flexible self-supporting carbon electrodes. Subsequently, the advancements in their application in energy storage devices are elucidated. Finally, an outlook on the potential of biomass self-supported carbon architectures and the challenges they face is provided.

The cohesive energy of transition metal nanoparticles is crucial to understanding their stability and fundamental properties, which are essential for developing new technologies and applications in fields such as catalysis, electronics, energy storage, and biomedical engineering. In this study, we systematically investigate the size-dependent cohesive energies of all the 3d, 4d, and 5d transition-metal nanoparticles using first-principles density functional theory calculations. Our results show that the cohesive energies of nanoparticles decrease with decreasing size due to the increased surface-to-volume ratio and quantum confinement effects. We also find that the size-dependent cohesive energy trends are different for different transition metals, with some metals exhibiting stronger size effects than others. Our findings provide insights into the fundamental properties of transition-metal nanoparticles and have potential implications for their applications in various fields such as catalysis, electronics, and biomedical engineering.

The present review article concludes with three different types of materials recently used to enhance the efficiency of supercapacitors. The first type involves carbon-based materials for storage and supercapacitor applications. The carbon materials could be obtained naturally and synthesized manually based on the needs. The second type discusses the recent advances in metal oxide materials for high-performance supercapacitors. The metal oxide materials involve in different types of attachment through the bi-tri metallic bonding, which enhances the specific capacitance. The third type involves recently advanced materials for high energy and power density application. The power and energy density of the materials is enhanced by the surface modification of the materials. In recent days, the MXene and Nano-composite materials seems to be an appropriate material to increase the power and energy density of the device.

The shortage of precooling equipment in litchi producing regions could lead to a high loss rate, poor quality of litchis. It is urgent to develop a portable precooling device for litchi producing regions. In this study, a novel spray hydrocooler with thermal energy storage (TES) were designed, fabricated, and tested. A simple mathematical model of TES capacity, ice coil thermal resistance and refrigeration system was employed to determine hydrocooler parameters. Then designed the structure of the spray hydrocooler. Maximum charging test was implemented with full TES capacity and litchi spray hydrocooling experiments were carried out at different charging times, spray flow rate, and litchi load with one-third TES capacity. Results showed that: (1) the spray hydrocooler allows for the rapid and effective precooling of litchis; (2) the hydrocooler can precool 299 kg litchis with one-third TES storage, meet the precooling requirements; (3) the effective TES capacity achieved 1.25×108 J at the maximum TES capacity of the hydrocooler, while the energy efficiency ratio (EER) is 2; (4) the precooling capacity was maximum and the average power consumption was minimum when the litchi load was 23 kg and the spray flow rate was 30 L min-1. Longer charging time is the most important factor in increasing precooling capacity and reducing average power consumption.

Currently there are strong and sustained growth trends observed in multi-disciplinary industrial technologies such as building-integrated photovoltaics and agrivoltaics, where renewable energy production is featured in building envelopes of varying degrees of transparency. Novel glass products can provide a combination of thermal energy savings and solar energy harvesting, enabled by either patterned-semiconductor thin-film energy converters on glass substrates, or by using luminescent concentrator-type approaches to achieve high transparency. Significant progress has been demonstrated recently in building integrated solar windows featuring visible light transmission of up to 70%, with electric power outputs of up to Pmax ~ 30-33 Wp/m2. Several slightly different designs were tested during 2021-2023 in a greenhouse installation at Murdoch University in Perth, Western Australia. The objective of this paper is to report on the field performance of these PV windows in the context of agrivoltaics, and to provide some detail of the performance differences measured in several solar window designs related to their glazing structure materials. Methods for the identification and quantification of long-term field performance differences and energy generation trends in solar windows of marginally different design types are reported. The paper also aims to outline the practical application potential of these transparent construction materials in built environments, focussing on the measured renewable energy figures and seasonal trends observed during the long-term study.

Electric energy is one of the driving forces in every country. The supply of electrical energy continues to present various challenges, such as high costs associated with procuring raw materials for generation, sparsely populated areas that are not connected to the main grid, and the need for infrastructure to support generation and network delivery. These challenges have contributed to the growing adoption of renewable energy sources, particularly solar photovoltaics (PV).In this study, we have developed a practical method to assess the spatial PV potential in a selected urban area. The methodology combines data collected from an unmanned aerial vehicle (UAV) photogrammetry, Geographic Information System (GIS), and the energy output from three remote photovoltaic systems installed at different locations. The results obtained from this approach not only provide the energy generated per square meter, per year (kWh m-2 yr-1), but also provides a base to calculate the potential distance that electric cars could travel based on the energy generated. To illustrate the application of this method, two practical cases were selected: Senglea, Malta, and Munxar, Gozo. These examples highlight the versatility and effectiveness of our approach for evaluating and harnessing solar energy through photovoltaic panels in different contexts.

The pace of implementation of renewable electricity storage in Europe is disappointingly slow. Several factors influence it, but there is a need to speed up the rate and increase the volumes in order to promote a 100% transition to renewable energy resources, expand the practice of using renewable energy, and contribute to the improvement of the user's quality of life. Also, an important factor is significantly reducing the global impact on the environment and climate change. Electricity from renewable energy sources such as solar and wind has a seasonal nature that cannot provide the necessary electricity consumption and cover peak loads. Also, the so-called "energy resource crisis" is a very topical problem at the moment, which reinforces the global need to increase the share of renewable energy resources in the overall balance of primary energy resources. It is precisely the wider integration of renewable electricity storage in practice that can help stimulate this. The availability of renewable electricity is constantly increasing and the level of technological innovation is rapidly developing, therefore it is valuable to analyze, look for connections and at the same time the main differences in the ways of accumulation in order to promote its availability from a private house to the national and European scale as a whole. Therefore, this article analyses and compares the different options for renewable electricity storage, from small batteries to large storage systems, arriving at the best solution according to needs, using analysis methods such as multicriteria decision analysis (MCDA) and TOPSIS. After comparing nine criteria, such as the amount of investment required, existing power density, efficiency, duration of operation and others, in both groups, it was concluded that lithium-ion batteries are currently the best solution among batteries, while in the group of large accumulation systems – pumped hydro storage.

Technological development has profoundly marked the evolution of the economy. The constant changes brought about by scientific and technological advances have been decisive in the transition from an analogue to a digital world. In this context, the impact of the fourth industrial revolution (or Industry 4.0.) manifests itself in many ways. Environmental impact is one of these. The energy sector has been evolving and changing just like the economy and society. Therefore, a study of this sector, and of the other related elements, is of interest to better understand the 4.0 concept. The promotion of sustainability at both political and social levels has led to changes in different areas, such as the productive vision, the use of green energies or the implementation of green taxes. Energy as a key factor in Industry 4.0. involves studying it both quantitatively and qualitatively. This is to under-stand the lights and shadows that the concept currently presents. Therefore, this work aims to bring the reality of the energy sector closer to reality, both in its positive and negative aspects, considering the main factors of incidence, in order to show the strengths and weaknesses that can be deduced.